VIMSS101876 has 201 amino acids
Query: Gly_transporter [M=78] Accession: PF03458.17 Description: Glycine transporter Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.6e-43 131.3 13.6 1.4e-23 68.9 3.0 2.3 2 VIMSS101876 Domain annotation for each sequence (and alignments): >> VIMSS101876 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 67.9 2.9 2.9e-23 2.9e-23 2 76 .. 4 77 .. 3 79 .. 0.86 2 ! 68.9 3.0 1.4e-23 1.4e-23 2 73 .. 91 160 .. 90 164 .. 0.94 Alignments for each domain: == domain 1 score: 67.9 bits; conditional E-value: 2.9e-23 Gly_transporter 2 vldaiGlaafavsGalkAlrkgldlfgvvvlGvvTavgGGvlRDvllgrevPvvllreplyalaallgallvvll 76 +l++iG++afa+sGa++A+++++d++g+++lG+vTa+gGG +R+ l+g + +++ ++ ++a+++++l++l+ VIMSS101876 4 ILNIIGTIAFALSGAIVAMEEEFDILGIFILGFVTAFGGGAIRNTLIGLPIEALWGQK-PEFTCAFFAMVLIMLF 77 799*********************************************7555556555.6678888888887776 PP == domain 2 score: 68.9 bits; conditional E-value: 1.4e-23 Gly_transporter 2 vldaiGlaafavsGalkAlrkgldlfgvvvlGvvTavgGGvlRDvllgrevPvvllreplyalaallgallv 73 + daiGlaaf+v Gal A+r + +l v+v +v+T+ gGGv+RD+l+gr P vl +e +ya ++l+a++ VIMSS101876 91 LTDAIGLAAFSVQGALHAVRLNQPLSAVIVTAVLTGAGGGVVRDILAGR-KPSVLRSE-IYAGWSILAAIVL 160 579*********************************************6.9****767.*********9986 PP
Or compare VIMSS101876 to CDD or PaperBLAST