VIMSS104870 has 205 amino acids
Query: Gly_transporter [M=78] Accession: PF03458.17 Description: Glycine transporter Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.8e-46 141.6 13.6 1.9e-25 74.9 1.5 2.2 2 VIMSS104870 Domain annotation for each sequence (and alignments): >> VIMSS104870 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 74.9 1.5 1.9e-25 1.9e-25 2 77 .. 7 81 .. 6 82 .. 0.96 2 ! 72.1 4.8 1.4e-24 1.4e-24 2 76 .. 95 167 .. 94 169 .. 0.96 Alignments for each domain: == domain 1 score: 74.9 bits; conditional E-value: 1.9e-25 Gly_transporter 2 vldaiGlaafavsGalkAlrkgldlfgvvvlGvvTavgGGvlRDvllgrevPvvllreplyalaallgallvvlla 77 +l++iG++af++sG lk+ +kgld+fgvv+lGv+T+ +GG++ D+llg +P+ +l+e y+l+++ +++v++++ VIMSS104870 7 LLNIIGIIAFTISGSLKGTNKGLDIFGVVTLGVITSYAGGIIADILLGI-YPPQILKELNYLLLSVGISIFVFYFY 81 689*********************************************7.999999*99**************997 PP == domain 2 score: 72.1 bits; conditional E-value: 1.4e-24 Gly_transporter 2 vldaiGlaafavsGalkAlrkgldlfgvvvlGvvTavgGGvlRDvllgrevPvvllreplyalaallgallvvll 76 + da+Gl fa Ga A ++gl+++ v +++ + ++gGGv+RDvl++ e+P+vl++e +ya+aall +++++++ VIMSS104870 95 ISDAVGLSTFATLGASLAYSYGLNPISVGLIAAIVGTGGGVIRDVLVN-EIPMVLTKE-IYATAALLSGFIYYFT 167 68**********************************************.7*****988.*************997 PP
Or compare VIMSS104870 to CDD or PaperBLAST