VIMSS122925 has 211 amino acids
Query: Gly_transporter [M=78] Accession: PF03458.17 Description: Glycine transporter Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-43 133.2 30.7 1.8e-26 78.2 6.5 3.0 3 VIMSS122925 Domain annotation for each sequence (and alignments): >> VIMSS122925 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 78.2 6.5 1.8e-26 1.8e-26 2 77 .. 6 80 .. 5 81 .. 0.96 2 ! 63.9 6.9 5e-22 5e-22 2 76 .. 92 164 .. 91 166 .. 0.95 3 ! 3.3 3.2 0.0042 0.0042 18 44 .. 163 191 .. 160 192 .. 0.81 Alignments for each domain: == domain 1 score: 78.2 bits; conditional E-value: 1.8e-26 Gly_transporter 2 vldaiGlaafavsGalkAlrkgldlfgvvvlGvvTavgGGvlRDvllgrevPvvllreplyalaallgallvvlla 77 +ld++G+a+fa++Gal A rk+ld++g ++l+ +T++gGG++RD++lg+ +Pv+++ +p ++++++++a++v+l++ VIMSS122925 6 FLDYAGVAIFAATGALSASRKQLDIIGYLFLASATGIGGGTIRDLVLGA-TPVFWVVNPNFIIVCAAVAVAVFLTS 80 79**********************************************6.*********************99875 PP == domain 2 score: 63.9 bits; conditional E-value: 5e-22 Gly_transporter 2 vldaiGlaafavsGalkAlrkgldlfgvvvlGvvTavgGGvlRDvllgrevPvvllr.eplyalaallgallvvll 76 +lda+Gl a++v+Ga k+l++ ++++++v G +Ta++GGvlRD+l+g+ P vllr e +y++aal+ga ++vl+ VIMSS122925 92 WLDALGLSAYCVMGAAKGLAATGSPIVALVTGALTATFGGVLRDLLAGE--PSVLLRpE-IYVSAALIGAGAFVLA 164 9***********************************************5..99999955.**********999875 PP == domain 3 score: 3.3 bits; conditional E-value: 0.0042 Gly_transporter 18 kAlrkgldlfgvvvlGvvTa..vgGGvlR 44 A +gl+l+ lGv+Ta v GG lR VIMSS122925 163 LASLAGLPLVATSALGVITAfaVRGGALR 191 56778999***********7336699988 PP
Or compare VIMSS122925 to CDD or PaperBLAST