PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS14303 to PF03458 (Gly_transporter)

VIMSS14303 has 207 amino acids

Query:       Gly_transporter  [M=78]
Accession:   PF03458.17
Description: Glycine transporter
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    5.6e-50  153.5  26.1    5.9e-29   86.1   7.2    2.4  3  VIMSS14303  


Domain annotation for each sequence (and alignments):
>> VIMSS14303  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   86.1   7.2   5.9e-29   5.9e-29       1      77 [.       4      79 ..       4      80 .. 0.97
   2 !   76.4   7.6   6.6e-26   6.6e-26       2      75 ..      92     163 ..      91     166 .. 0.94
   3 ?   -3.5   0.1      0.55      0.55      65      74 ..     175     184 ..     173     187 .. 0.54

  Alignments for each domain:
  == domain 1  score: 86.1 bits;  conditional E-value: 5.9e-29
  Gly_transporter  1 lvldaiGlaafavsGalkAlrkgldlfgvvvlGvvTavgGGvlRDvllgrevPvvllreplyalaallgallvvlla 77
                     ++ld++G+a+fa+sG+l A + ++d+fgv+vlGvvTavgGG++RD+ l++  Pv+++++p+ +++a+++++l+++l 
       VIMSS14303  4 YWLDIVGTAVFAISGVLLAGKLRMDPFGVLVLGVVTAVGGGTIRDMALDH-GPVFWVKDPTDLVVAMVTSMLTIVLV 79
                     59***********************************************6.9*********************9985 PP

  == domain 2  score: 76.4 bits;  conditional E-value: 6.6e-26
  Gly_transporter   2 vldaiGlaafavsGalkAlrkgldlfgvvvlGvvTavgGGvlRDvllgrevPvvllreplyalaallgallvvl 75 
                      vlda+Gla+f  +G+ kA +++  ++++v++Gv+T+vgGG++RDvl++ e+P++l +e +ya+a+++g+++ + 
       VIMSS14303  92 VLDAVGLAVFVGIGVNKAFNAEAGPLIAVCMGVITGVGGGIIRDVLAR-EIPMILRTE-IYATACIIGGIVHAT 163
                      79**********************************************.7*****777.**********99765 PP

  == domain 3  score: -3.5 bits;  conditional E-value: 0.55
  Gly_transporter  65 aallgallvv 74 
                      a+++g+++++
       VIMSS14303 175 ASMMGMVVTL 184
                      4555555555 PP



Or compare VIMSS14303 to CDD or PaperBLAST