VIMSS14303 has 207 amino acids
Query: Gly_transporter [M=78] Accession: PF03458.17 Description: Glycine transporter Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.6e-50 153.5 26.1 5.9e-29 86.1 7.2 2.4 3 VIMSS14303 Domain annotation for each sequence (and alignments): >> VIMSS14303 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 86.1 7.2 5.9e-29 5.9e-29 1 77 [. 4 79 .. 4 80 .. 0.97 2 ! 76.4 7.6 6.6e-26 6.6e-26 2 75 .. 92 163 .. 91 166 .. 0.94 3 ? -3.5 0.1 0.55 0.55 65 74 .. 175 184 .. 173 187 .. 0.54 Alignments for each domain: == domain 1 score: 86.1 bits; conditional E-value: 5.9e-29 Gly_transporter 1 lvldaiGlaafavsGalkAlrkgldlfgvvvlGvvTavgGGvlRDvllgrevPvvllreplyalaallgallvvlla 77 ++ld++G+a+fa+sG+l A + ++d+fgv+vlGvvTavgGG++RD+ l++ Pv+++++p+ +++a+++++l+++l VIMSS14303 4 YWLDIVGTAVFAISGVLLAGKLRMDPFGVLVLGVVTAVGGGTIRDMALDH-GPVFWVKDPTDLVVAMVTSMLTIVLV 79 59***********************************************6.9*********************9985 PP == domain 2 score: 76.4 bits; conditional E-value: 6.6e-26 Gly_transporter 2 vldaiGlaafavsGalkAlrkgldlfgvvvlGvvTavgGGvlRDvllgrevPvvllreplyalaallgallvvl 75 vlda+Gla+f +G+ kA +++ ++++v++Gv+T+vgGG++RDvl++ e+P++l +e +ya+a+++g+++ + VIMSS14303 92 VLDAVGLAVFVGIGVNKAFNAEAGPLIAVCMGVITGVGGGIIRDVLAR-EIPMILRTE-IYATACIIGGIVHAT 163 79**********************************************.7*****777.**********99765 PP == domain 3 score: -3.5 bits; conditional E-value: 0.55 Gly_transporter 65 aallgallvv 74 a+++g+++++ VIMSS14303 175 ASMMGMVVTL 184 4555555555 PP
Or compare VIMSS14303 to CDD or PaperBLAST