VIMSS151019 has 205 amino acids
Query: Gly_transporter [M=78] Accession: PF03458.17 Description: Glycine transporter Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-47 145.0 23.6 5.1e-26 76.7 6.7 2.8 3 VIMSS151019 Domain annotation for each sequence (and alignments): >> VIMSS151019 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 76.7 6.7 5.1e-26 5.1e-26 2 76 .. 5 78 .. 4 80 .. 0.95 2 ! 76.2 5.4 7.3e-26 7.3e-26 2 77 .. 91 164 .. 90 165 .. 0.96 3 ? -0.2 0.1 0.051 0.051 5 27 .. 174 196 .. 172 200 .. 0.81 Alignments for each domain: == domain 1 score: 76.7 bits; conditional E-value: 5.1e-26 Gly_transporter 2 vldaiGlaafavsGalkAlrkgldlfgvvvlGvvTavgGGvlRDvllgrevPvvllreplyalaallgallvvll 76 vl +iG+ a a++Gal+A r+++d fgv++++++Ta+gGG +RD+llg+ +P+ ++++p y+++++ +a+l+ ++ VIMSS151019 5 VLYLIGITAEAMTGALAAGRRRMDTFGVIIIATATAIGGGSVRDILLGH-YPLGWVKHPEYVIIVATAAVLTTIV 78 7899********************************************6.***********99999999999876 PP == domain 2 score: 76.2 bits; conditional E-value: 7.3e-26 Gly_transporter 2 vldaiGlaafavsGalkAlrkgldlfgvvvlGvvTavgGGvlRDvllgrevPvvllreplyalaallgallvvlla 77 vlda+Gl++f+++Ga++Al++g ++++vv +v+T+v+GGvlRD++++r +P+v+ +e lya ++++ a+l+++l+ VIMSS151019 91 VLDALGLVVFSIIGAQIALDMGEGPIIAVVAAVTTGVFGGVLRDMFCKR-IPLVFQKE-LYAGISFASAVLYIALQ 164 89**********************************************5.*****777.**************987 PP == domain 3 score: -0.2 bits; conditional E-value: 0.051 Gly_transporter 5 aiGlaafavsGalkAlrkgldlf 27 +i +++f ++ l Alr +l l VIMSS151019 174 VISTLLFGFTARLLALRLKLGLP 196 57899999999999999988765 PP
Or compare VIMSS151019 to CDD or PaperBLAST