VIMSS208171 has 207 amino acids
Query: Gly_transporter [M=78] Accession: PF03458.17 Description: Glycine transporter Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.4e-48 146.9 30.3 2.9e-28 83.9 8.7 2.2 2 VIMSS208171 Domain annotation for each sequence (and alignments): >> VIMSS208171 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 83.9 8.7 2.9e-28 2.9e-28 2 77 .. 7 81 .. 6 82 .. 0.93 2 ! 69.1 13.5 1.2e-23 1.2e-23 2 76 .. 93 165 .. 92 167 .. 0.95 Alignments for each domain: == domain 1 score: 83.9 bits; conditional E-value: 2.9e-28 Gly_transporter 2 vldaiGlaafavsGalkAlrkgldlfgvvvlGvvTavgGGvlRDvllgrevPvvllreplyalaallgallvvlla 77 +ld++G++afav+GalkA+r++ld++gv+vl++vT+vgGG++RD++l P++++++ y+l++l+g+llv+++a VIMSS208171 7 ALDIFGTFAFAVAGALKAARHELDALGVLVLATVTGVGGGMVRDMMLAY-GPPAVFHNDAYLLVCLAGGLLVFFFA 81 69**********************************************7.566666766***************97 PP == domain 2 score: 69.1 bits; conditional E-value: 1.2e-23 Gly_transporter 2 vldaiGlaafavsGalkAlrkgldlfgvvvlGvvTavgGGvlRDvllgrevPvvllreplyalaallgallvvll 76 ++da+Gl++f+++G kA++ gl + vv+l+v+Ta+gGGv+RDvl+g evP+vl ++ +ya+a++lga++ + l VIMSS208171 93 YADAVGLGVFTAIGGAKAMAFGLGGLPVVFLAVLTATGGGVIRDVLVG-EVPAVLRTD-FYATASILGAVALLGL 165 68**********************************************.7*****778.**********998765 PP
Or compare VIMSS208171 to CDD or PaperBLAST