VIMSS220540 has 203 amino acids
Query: Gly_transporter [M=78] Accession: PF03458.17 Description: Glycine transporter Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.5e-49 150.6 19.5 3.1e-27 80.6 4.7 2.2 2 VIMSS220540 Domain annotation for each sequence (and alignments): >> VIMSS220540 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 80.6 4.7 3.1e-27 3.1e-27 2 77 .. 4 78 .. 3 79 .. 0.95 2 ! 75.9 6.9 9.1e-26 9.1e-26 2 76 .. 90 162 .. 89 164 .. 0.95 Alignments for each domain: == domain 1 score: 80.6 bits; conditional E-value: 3.1e-27 Gly_transporter 2 vldaiGlaafavsGalkAlrkgldlfgvvvlGvvTavgGGvlRDvllgrevPvvllreplyalaallgallvvlla 77 +l +i++ a a++Gal A r+g+d+fgvv++++vTa+gGG +RDvllg+ +P+ ++++p y++++ ++all++++a VIMSS220540 4 MLYLIAITAEAMTGALSAGRRGMDWFGVVLIACVTALGGGSVRDVLLGH-YPLTWVKHPEYLVLTSFAALLTIFIA 78 6789********************************************6.*********************99975 PP == domain 2 score: 75.9 bits; conditional E-value: 9.1e-26 Gly_transporter 2 vldaiGlaafavsGalkAlrkgldlfgvvvlGvvTavgGGvlRDvllgrevPvvllreplyalaallgallvvll 76 vlda+Gl+af+++G+++Al++g ++++ + Gv+T+v+GG+lRD++++ ++P+v+ re lya++++++a++++ + VIMSS220540 90 VLDALGLVAFTLIGCMTALEMGQGMLVASISGVITGVFGGILRDIFCN-DIPLVFRRE-LYASVSFAAAWFYLGC 162 89**********************************************.5*****888.************9865 PP
Or compare VIMSS220540 to CDD or PaperBLAST