VIMSS244376 has 218 amino acids
Query: Gly_transporter [M=78] Accession: PF03458.17 Description: Glycine transporter Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-45 139.7 34.0 1.2e-25 75.6 11.9 2.8 3 VIMSS244376 Domain annotation for each sequence (and alignments): >> VIMSS244376 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 73.5 9.3 5e-25 5e-25 2 77 .. 10 85 .. 9 86 .. 0.95 2 ! 75.6 11.9 1.2e-25 1.2e-25 2 76 .. 97 169 .. 96 171 .. 0.95 3 ? -0.4 0.2 0.061 0.061 61 76 .. 174 189 .. 168 191 .. 0.67 Alignments for each domain: == domain 1 score: 73.5 bits; conditional E-value: 5e-25 Gly_transporter 2 vldaiGlaafavsGalkAlrk.gldlfgvvvlGvvTavgGGvlRDvllgrevPvvllreplyalaallgallvvlla 77 +ld+ G++af + Gal+A+r+ +ld++gvvvlG++Ta+gGGv+RDvl+++ P++++ ++ y ++a++g+ll+++++ VIMSS244376 10 ALDLTGTFAFGLNGALTAVRAaRLDVVGVVVLGMITALGGGVIRDVLIDS-LPPAAFLDWRYYTLAAAGGLLAFAVS 85 69*****************9889**************************6.99999999**************9875 PP == domain 2 score: 75.6 bits; conditional E-value: 1.2e-25 Gly_transporter 2 vldaiGlaafavsGalkAlrkgldlfgvvvlGvvTavgGGvlRDvllgrevPvvllreplyalaallgallvvll 76 vlda+Gl fav+Ga kAl++gl ++ +++lGv+TavgGG++RD l+gr +P+vl + lya++al+ga+++v++ VIMSS244376 97 VLDAVGLSTFAVIGASKALDAGLAVVPAMLLGVITAVGGGTIRDTLVGR-IPTVLRTG-LYAIPALAGAAVTVAT 169 89**********************************************5.*****666.************9976 PP == domain 3 score: -0.4 bits; conditional E-value: 0.061 Gly_transporter 61 lyalaallgallvvll 76 +y l+a+lga++v++l VIMSS244376 174 VYGLPAALGAAAVCFL 189 6777777777777665 PP
Or compare VIMSS244376 to CDD or PaperBLAST