PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS54702 to PF03458 (Gly_transporter)

VIMSS54702 has 207 amino acids

Query:       Gly_transporter  [M=78]
Accession:   PF03458.17
Description: Glycine transporter
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
      2e-48  148.5  16.8    3.4e-27   80.5   3.2    2.4  3  VIMSS54702  


Domain annotation for each sequence (and alignments):
>> VIMSS54702  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   80.5   3.2   3.4e-27   3.4e-27       2      76 ..       5      78 ..       4      80 .. 0.89
   2 !   77.2   1.9   3.5e-26   3.5e-26       3      76 ..      92     163 ..      90     165 .. 0.93
   3 ?   -2.7   0.1      0.31      0.31       5      16 ..     171     182 ..     168     190 .. 0.52

  Alignments for each domain:
  == domain 1  score: 80.5 bits;  conditional E-value: 3.4e-27
  Gly_transporter  2 vldaiGlaafavsGalkAlrkgldlfgvvvlGvvTavgGGvlRDvllgrevPvvllreplyalaallgallvvll 76
                     vl +iG+ a a++Gal A r+++d+fgv++++ +Ta+gGG++RD+llg+ +P+ ++++p y+++++++++l+ ++
       VIMSS54702  5 VLYIIGITAEAMTGALSAGRRKMDWFGVMLVASATAIGGGTVRDILLGH-YPLGWVKNPEYLAITCVAGVLTTWV 78
                     6889********************************************6.*******999977766666666655 PP

  == domain 2  score: 77.2 bits;  conditional E-value: 3.5e-26
  Gly_transporter   3 ldaiGlaafavsGalkAlrkgldlfgvvvlGvvTavgGGvlRDvllgrevPvvllreplyalaallgallvvll 76 
                      lda+Gl++f+++G+++A+r+gl++ +++v +vvT+v+GG+lRD+++++  P+vl +e+lya++all++ l+++l
       VIMSS54702  92 LDALGLIVFSIIGTQVAMRMGLHPGICLVSAVVTGVFGGLLRDLICRQ-PPLVL-HEELYASIALLASGLYLAL 163
                      8**********************************************5.88888.556************9986 PP

  == domain 3  score: -2.7 bits;  conditional E-value: 0.31
  Gly_transporter   5 aiGlaafavsGa 16 
                      ++ +++  v+G 
       VIMSS54702 171 VVSTVVTLVVGY 182
                      444444444443 PP



Or compare VIMSS54702 to CDD or PaperBLAST