VIMSS54702 has 207 amino acids
Query: Gly_transporter [M=78] Accession: PF03458.17 Description: Glycine transporter Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-48 148.5 16.8 3.4e-27 80.5 3.2 2.4 3 VIMSS54702 Domain annotation for each sequence (and alignments): >> VIMSS54702 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 80.5 3.2 3.4e-27 3.4e-27 2 76 .. 5 78 .. 4 80 .. 0.89 2 ! 77.2 1.9 3.5e-26 3.5e-26 3 76 .. 92 163 .. 90 165 .. 0.93 3 ? -2.7 0.1 0.31 0.31 5 16 .. 171 182 .. 168 190 .. 0.52 Alignments for each domain: == domain 1 score: 80.5 bits; conditional E-value: 3.4e-27 Gly_transporter 2 vldaiGlaafavsGalkAlrkgldlfgvvvlGvvTavgGGvlRDvllgrevPvvllreplyalaallgallvvll 76 vl +iG+ a a++Gal A r+++d+fgv++++ +Ta+gGG++RD+llg+ +P+ ++++p y+++++++++l+ ++ VIMSS54702 5 VLYIIGITAEAMTGALSAGRRKMDWFGVMLVASATAIGGGTVRDILLGH-YPLGWVKNPEYLAITCVAGVLTTWV 78 6889********************************************6.*******999977766666666655 PP == domain 2 score: 77.2 bits; conditional E-value: 3.5e-26 Gly_transporter 3 ldaiGlaafavsGalkAlrkgldlfgvvvlGvvTavgGGvlRDvllgrevPvvllreplyalaallgallvvll 76 lda+Gl++f+++G+++A+r+gl++ +++v +vvT+v+GG+lRD+++++ P+vl +e+lya++all++ l+++l VIMSS54702 92 LDALGLIVFSIIGTQVAMRMGLHPGICLVSAVVTGVFGGLLRDLICRQ-PPLVL-HEELYASIALLASGLYLAL 163 8**********************************************5.88888.556************9986 PP == domain 3 score: -2.7 bits; conditional E-value: 0.31 Gly_transporter 5 aiGlaafavsGa 16 ++ +++ v+G VIMSS54702 171 VVSTVVTLVVGY 182 444444444443 PP
Or compare VIMSS54702 to CDD or PaperBLAST