VIMSS561959 has 210 amino acids
Query: Gly_transporter [M=78]
Accession: PF03458.17
Description: Glycine transporter
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.2e-50 155.6 26.9 4.9e-30 89.6 4.6 2.3 3 VIMSS561959
Domain annotation for each sequence (and alignments):
>> VIMSS561959
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 89.6 4.6 4.9e-30 4.9e-30 2 77 .. 14 87 .. 13 88 .. 0.96
2 ! 77.6 8.5 2.6e-26 2.6e-26 2 76 .. 99 171 .. 98 173 .. 0.96
3 ? -4.0 0.3 0.79 0.79 69 74 .. 185 190 .. 180 195 .. 0.45
Alignments for each domain:
== domain 1 score: 89.6 bits; conditional E-value: 4.9e-30
Gly_transporter 2 vldaiGlaafavsGalkAlrkgldlfgvvvlGvvTavgGGvlRDvllgrevPvvllreplyalaallgallvvlla 77
++d++G++afa+sG+ A+++++d+fg++v+GvvTavgGG++RD+ll+ vP++++ p y+ +++l+ +++++++
VIMSS561959 14 WCDYLGTFAFAISGIRLAAARRFDWFGAYVVGVVTAVGGGTVRDILLN--VPPFWMLRPSYLFISMLALIFTIVFR 87
89**********************************************..6****999***************996 PP
== domain 2 score: 77.6 bits; conditional E-value: 2.6e-26
Gly_transporter 2 vldaiGlaafavsGalkAlrkgldlfgvvvlGvvTavgGGvlRDvllgrevPvvllreplyalaallgallvvll 76
++d++G+++f+++G+ k + g+ ++ ++ +G++T+ +GG++RD+l++ ++P+++ ++ +ya+a+l+g++++v l
VIMSS561959 99 IFDTVGIGLFTIVGVAKTFECGYAWWLAIAMGTITGSFGGMIRDILIN-QTPLIFRKD-IYAMACLIGGAVYVGL 171
89**********************************************.5*****878.*************976 PP
== domain 3 score: -4.0 bits; conditional E-value: 0.79
Gly_transporter 69 gallvv 74
+a++vv
VIMSS561959 185 AAFIVV 190
222222 PP
Or compare VIMSS561959 to CDD or PaperBLAST