VIMSS5672751 has 205 amino acids
Query: Gly_transporter [M=78] Accession: PF03458.17 Description: Glycine transporter Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-43 132.7 14.1 7.6e-24 69.7 3.2 2.3 2 VIMSS5672751 Domain annotation for each sequence (and alignments): >> VIMSS5672751 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 69.7 3.2 7.6e-24 7.6e-24 2 76 .. 8 81 .. 7 83 .. 0.86 2 ! 68.6 3.3 1.8e-23 1.8e-23 2 73 .. 95 164 .. 94 168 .. 0.94 Alignments for each domain: == domain 1 score: 69.7 bits; conditional E-value: 7.6e-24 Gly_transporter 2 vldaiGlaafavsGalkAlrkgldlfgvvvlGvvTavgGGvlRDvllgrevPvvllreplyalaallgallvvll 76 +l++iG++afa+sGa++A+++++d++g+++lG+vTa+gGG +R++l+g + +++ ++ ++a+++++l++l+ VIMSS5672751 8 ILNIIGTIAFALSGAIVAMEEEFDILGIFILGFVTAFGGGAIRNILIGLPIEALWGQK-PEFTCAFFAMVLIMLF 81 799*********************************************7555556555.6678888888887776 PP == domain 2 score: 68.6 bits; conditional E-value: 1.8e-23 Gly_transporter 2 vldaiGlaafavsGalkAlrkgldlfgvvvlGvvTavgGGvlRDvllgrevPvvllreplyalaallgallv 73 + daiGlaaf+v Gal A+r + +l v+v +v+T+ gGGv+RD+l+gr P vl +e +ya ++l+a++ VIMSS5672751 95 LTDAIGLAAFSVQGALHAVRLNQPLSAVIVAAVLTGAGGGVVRDILAGR-KPSVLRSE-IYAGWSILAAIVL 164 579*********************************************6.9****767.*********9986 PP
Or compare VIMSS5672751 to CDD or PaperBLAST