VIMSS5724110 has 205 amino acids
Query: Gly_transporter [M=78]
Accession: PF03458.17
Description: Glycine transporter
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.3e-47 145.1 25.0 4.8e-26 76.8 6.5 2.4 3 VIMSS5724110
Domain annotation for each sequence (and alignments):
>> VIMSS5724110
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 76.8 6.5 4.8e-26 4.8e-26 2 76 .. 5 78 .. 4 80 .. 0.94
2 ! 76.3 8.2 6.7e-26 6.7e-26 2 77 .. 91 164 .. 90 165 .. 0.96
3 ? -2.7 0.0 0.32 0.32 31 37 .. 175 181 .. 169 195 .. 0.58
Alignments for each domain:
== domain 1 score: 76.8 bits; conditional E-value: 4.8e-26
Gly_transporter 2 vldaiGlaafavsGalkAlrkgldlfgvvvlGvvTavgGGvlRDvllgrevPvvllreplyalaallgallvvll 76
vl +iG+ a a++Gal+A r+++d+fgv++++ +Ta+gGG +RD+llg+ +P+ ++++p y+++++++a+++ ++
VIMSS5724110 5 VLYIIGITAEAMTGALAAGRRQMDMFGVIIIASATAIGGGSVRDMLLGH-YPLGWVKHPEYIVIVAIAAIVTTWM 78
6889********************************************6.***********99999999998876 PP
== domain 2 score: 76.3 bits; conditional E-value: 6.7e-26
Gly_transporter 2 vldaiGlaafavsGalkAlrkgldlfgvvvlGvvTavgGGvlRDvllgrevPvvllreplyalaallgallvvlla 77
vldaiGl++f+++Ga++Al++g++ +++++ +v+T+v+GGvlRD+l++ +P+v+ +e +ya +++++a+++++l+
VIMSS5724110 91 VLDAIGLIVFSIIGAQIALDMGHSTIIAAIAAVITGVFGGVLRDMLCNC-IPLVFQKE-IYAGISFAAAWIYIALQ 164
89**********************************************5.*****777.*************9986 PP
== domain 3 score: -2.7 bits; conditional E-value: 0.32
Gly_transporter 31 vlGvvTa 37
++ ++T+
VIMSS5724110 175 IITLITG 181
3333333 PP
Or compare VIMSS5724110 to CDD or PaperBLAST