VIMSS57488 has 206 amino acids
Query: Gly_transporter [M=78] Accession: PF03458.17 Description: Glycine transporter Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.2e-50 153.1 17.4 1.9e-27 81.3 3.2 2.1 2 VIMSS57488 Domain annotation for each sequence (and alignments): >> VIMSS57488 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 77.9 6.5 2.2e-26 2.2e-26 2 77 .. 5 79 .. 4 80 .. 0.95 2 ! 81.3 3.2 1.9e-27 1.9e-27 2 76 .. 91 163 .. 90 165 .. 0.96 Alignments for each domain: == domain 1 score: 77.9 bits; conditional E-value: 2.2e-26 Gly_transporter 2 vldaiGlaafavsGalkAlrkgldlfgvvvlGvvTavgGGvlRDvllgrevPvvllreplyalaallgallvvlla 77 vl +i++ a a++Gal A r+ +dlfgvv++++vTa+gGG +RD+llg+ +P+ ++r+p y+++++++al++v++a VIMSS57488 5 VLYIIAITAEAMTGALSAGRRSMDLFGVVLIACVTALGGGSVRDMLLGH-YPLTWVRHPEYLALTAVAALVTVFIA 79 7889********************************************6.***********999999999999975 PP == domain 2 score: 81.3 bits; conditional E-value: 1.9e-27 Gly_transporter 2 vldaiGlaafavsGalkAlrkgldlfgvvvlGvvTavgGGvlRDvllgrevPvvllreplyalaallgallvvll 76 vlda+Gl+af+++G+++ l++g++l+++++ Gv+T+v+GG+lRD+l++ +vP+++ re lya+++++ a++++++ VIMSS57488 91 VLDAVGLVAFTLIGCQVSLEMGHSLLIAAISGVITGVFGGILRDILCN-DVPLIFRRE-LYASVSFASAWCYLIC 163 89**********************************************.5*****888.*************987 PP
Or compare VIMSS57488 to CDD or PaperBLAST