PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS57488 to PF03458 (Gly_transporter)

VIMSS57488 has 206 amino acids

Query:       Gly_transporter  [M=78]
Accession:   PF03458.17
Description: Glycine transporter
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    7.2e-50  153.1  17.4    1.9e-27   81.3   3.2    2.1  2  VIMSS57488  


Domain annotation for each sequence (and alignments):
>> VIMSS57488  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   77.9   6.5   2.2e-26   2.2e-26       2      77 ..       5      79 ..       4      80 .. 0.95
   2 !   81.3   3.2   1.9e-27   1.9e-27       2      76 ..      91     163 ..      90     165 .. 0.96

  Alignments for each domain:
  == domain 1  score: 77.9 bits;  conditional E-value: 2.2e-26
  Gly_transporter  2 vldaiGlaafavsGalkAlrkgldlfgvvvlGvvTavgGGvlRDvllgrevPvvllreplyalaallgallvvlla 77
                     vl +i++ a a++Gal A r+ +dlfgvv++++vTa+gGG +RD+llg+ +P+ ++r+p y+++++++al++v++a
       VIMSS57488  5 VLYIIAITAEAMTGALSAGRRSMDLFGVVLIACVTALGGGSVRDMLLGH-YPLTWVRHPEYLALTAVAALVTVFIA 79
                     7889********************************************6.***********999999999999975 PP

  == domain 2  score: 81.3 bits;  conditional E-value: 1.9e-27
  Gly_transporter   2 vldaiGlaafavsGalkAlrkgldlfgvvvlGvvTavgGGvlRDvllgrevPvvllreplyalaallgallvvll 76 
                      vlda+Gl+af+++G+++ l++g++l+++++ Gv+T+v+GG+lRD+l++ +vP+++ re lya+++++ a++++++
       VIMSS57488  91 VLDAVGLVAFTLIGCQVSLEMGHSLLIAAISGVITGVFGGILRDILCN-DVPLIFRRE-LYASVSFASAWCYLIC 163
                      89**********************************************.5*****888.*************987 PP



Or compare VIMSS57488 to CDD or PaperBLAST