PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS5784967 to PF03458 (Gly_transporter)

VIMSS5784967 has 205 amino acids

Query:       Gly_transporter  [M=78]
Accession:   PF03458.17
Description: Glycine transporter
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    2.1e-46  142.0  25.0    3.2e-26   77.4   6.0    2.4  3  VIMSS5784967  


Domain annotation for each sequence (and alignments):
>> VIMSS5784967  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   77.4   6.0   3.2e-26   3.2e-26       2      76 ..       5      78 ..       4      80 .. 0.95
   2 !   73.4   7.8   5.6e-25   5.6e-25       2      75 ..      91     162 ..      90     164 .. 0.95
   3 ?   -2.7   0.1      0.31      0.31       8      15 ..     178     185 ..     172     197 .. 0.50

  Alignments for each domain:
  == domain 1  score: 77.4 bits;  conditional E-value: 3.2e-26
  Gly_transporter  2 vldaiGlaafavsGalkAlrkgldlfgvvvlGvvTavgGGvlRDvllgrevPvvllreplyalaallgallvvll 76
                     vl +iG+ a a++Gal+A r+++d+fgv++++ +Ta+gGG +RD+llg+ +P+ ++++p y+++++++a++++++
     VIMSS5784967  5 VLYIIGITAEAMTGALAAGRRKMDVFGVIIIASATAIGGGSVRDILLGH-YPLGWVKHPEYIVTVACAAVITIWV 78
                     6889********************************************6.***********99999999999876 PP

  == domain 2  score: 73.4 bits;  conditional E-value: 5.6e-25
  Gly_transporter   2 vldaiGlaafavsGalkAlrkgldlfgvvvlGvvTavgGGvlRDvllgrevPvvllreplyalaallgallvvl 75 
                      +ld iGl++f+++Ga++Al++++ ++++++ +v+T+ +GGvlRD+l++ ++P+v+ +e +ya +a+ +a+l++ 
     VIMSS5784967  91 ILDSIGLMVFSIIGAQIALDMEYGPIIAAIAAVITGAFGGVLRDMLCN-TIPLVFQKE-IYAGVAFGAAWLYMG 162
                      89**********************************************.5*****777.************986 PP

  == domain 3  score: -2.7 bits;  conditional E-value: 0.31
  Gly_transporter   8 laafavsG 15 
                      +++  ++ 
     VIMSS5784967 178 TLVAGLTA 185
                      22223333 PP



Or compare VIMSS5784967 to CDD or PaperBLAST