VIMSS743663 has 202 amino acids
Query: Gly_transporter [M=78] Accession: PF03458.17 Description: Glycine transporter Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-44 136.6 23.6 6.4e-25 73.2 6.6 2.5 2 VIMSS743663 Domain annotation for each sequence (and alignments): >> VIMSS743663 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 73.2 6.6 6.4e-25 6.4e-25 3 75 .. 4 75 .. 2 78 .. 0.94 2 ! 71.8 6.0 1.7e-24 1.7e-24 2 76 .. 89 161 .. 88 163 .. 0.95 Alignments for each domain: == domain 1 score: 73.2 bits; conditional E-value: 6.4e-25 Gly_transporter 3 ldaiGlaafavsGalkAlrkgldlfgvvvlGvvTavgGGvlRDvllgrevPvvllreplyalaallgallvvl 75 l +i+++a a+sGal+++++g+d fg +++G vTa+gGG++RDvllgr +P+ ++ +p y+l++l++a+++ + VIMSS743663 4 LYLIAIVAEAMSGALMGMQRGMDRFGLALVGAVTALGGGTVRDVLLGR-YPLTWVAHPEYLLLTLAAATFASM 75 779********************************************5.******************998865 PP == domain 2 score: 71.8 bits; conditional E-value: 1.7e-24 Gly_transporter 2 vldaiGlaafavsGalkAlrkgldlfgvvvlGvvTavgGGvlRDvllgrevPvvllreplyalaallgallvvll 76 ++da+Glaaf+++G+ +A++ + +++++v+ G +T+v GG+lRD+l++ e+P+vl +e lya++all++ l+v + VIMSS743663 89 AVDALGLAAFSIIGCDVAAAVNGSPVVIVLAGAITGVCGGMLRDLLCN-EMPLVLRKE-LYASIALLTGGLYVGM 161 68**********************************************.7*****777.************9976 PP
Or compare VIMSS743663 to CDD or PaperBLAST