VIMSS759184 has 209 amino acids
Query: Gly_transporter [M=78] Accession: PF03458.17 Description: Glycine transporter Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.9e-47 144.8 19.4 4.1e-27 80.2 3.9 2.4 3 VIMSS759184 Domain annotation for each sequence (and alignments): >> VIMSS759184 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 74.3 3.4 2.9e-25 2.9e-25 3 77 .. 6 79 .. 4 80 .. 0.93 2 ! 80.2 3.9 4.1e-27 4.1e-27 2 76 .. 91 163 .. 90 165 .. 0.95 3 ? -2.7 0.1 0.31 0.31 63 75 .. 178 190 .. 170 192 .. 0.53 Alignments for each domain: == domain 1 score: 74.3 bits; conditional E-value: 2.9e-25 Gly_transporter 3 ldaiGlaafavsGalkAlrkgldlfgvvvlGvvTavgGGvlRDvllgrevPvvllreplyalaallgallvvlla 77 l ++G+ + a++Gal+A rk++d+fgv++++ +Ta+gGG++RD l + ++P+ ++ +p y+l + + a+l++++a VIMSS759184 6 LFIVGICVEAITGALAAGRKKMDFFGVLLIASITALGGGTVRDTLFN-TYPLTWVAHPEYLLYTSVCAFLTIFIA 79 6789*******************************************.5***********999999999998875 PP == domain 2 score: 80.2 bits; conditional E-value: 4.1e-27 Gly_transporter 2 vldaiGlaafavsGalkAlrkgldlfgvvvlGvvTavgGGvlRDvllgrevPvvllreplyalaallgallvvll 76 +lda+Gl f ++G++k l++g+++ ++v+ G++T++ GG+lRD+l++ ++P+vl +e lya++al+gall++ l VIMSS759184 91 ILDALGLSTFVIIGTQKVLAHGMPPSVAVISGMITGICGGMLRDILCN-DIPLVLRKE-LYAVIALAGALLFITL 163 89**********************************************.5*****777.************9987 PP == domain 3 score: -2.7 bits; conditional E-value: 0.31 Gly_transporter 63 alaallgallvvl 75 +l+++ + ll+++ VIMSS759184 178 LLCIFTARLLAIF 190 4444444455554 PP
Or compare VIMSS759184 to CDD or PaperBLAST