PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS759184 to PF03458 (Gly_transporter)

VIMSS759184 has 209 amino acids

Query:       Gly_transporter  [M=78]
Accession:   PF03458.17
Description: Glycine transporter
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    2.9e-47  144.8  19.4    4.1e-27   80.2   3.9    2.4  3  VIMSS759184  


Domain annotation for each sequence (and alignments):
>> VIMSS759184  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   74.3   3.4   2.9e-25   2.9e-25       3      77 ..       6      79 ..       4      80 .. 0.93
   2 !   80.2   3.9   4.1e-27   4.1e-27       2      76 ..      91     163 ..      90     165 .. 0.95
   3 ?   -2.7   0.1      0.31      0.31      63      75 ..     178     190 ..     170     192 .. 0.53

  Alignments for each domain:
  == domain 1  score: 74.3 bits;  conditional E-value: 2.9e-25
  Gly_transporter  3 ldaiGlaafavsGalkAlrkgldlfgvvvlGvvTavgGGvlRDvllgrevPvvllreplyalaallgallvvlla 77
                     l ++G+ + a++Gal+A rk++d+fgv++++ +Ta+gGG++RD l + ++P+ ++ +p y+l + + a+l++++a
      VIMSS759184  6 LFIVGICVEAITGALAAGRKKMDFFGVLLIASITALGGGTVRDTLFN-TYPLTWVAHPEYLLYTSVCAFLTIFIA 79
                     6789*******************************************.5***********999999999998875 PP

  == domain 2  score: 80.2 bits;  conditional E-value: 4.1e-27
  Gly_transporter   2 vldaiGlaafavsGalkAlrkgldlfgvvvlGvvTavgGGvlRDvllgrevPvvllreplyalaallgallvvll 76 
                      +lda+Gl  f ++G++k l++g+++ ++v+ G++T++ GG+lRD+l++ ++P+vl +e lya++al+gall++ l
      VIMSS759184  91 ILDALGLSTFVIIGTQKVLAHGMPPSVAVISGMITGICGGMLRDILCN-DIPLVLRKE-LYAVIALAGALLFITL 163
                      89**********************************************.5*****777.************9987 PP

  == domain 3  score: -2.7 bits;  conditional E-value: 0.31
  Gly_transporter  63 alaallgallvvl 75 
                      +l+++ + ll+++
      VIMSS759184 178 LLCIFTARLLAIF 190
                      4444444455554 PP



Or compare VIMSS759184 to CDD or PaperBLAST