VIMSS7740322 has 203 amino acids
Query: Gly_transporter [M=78] Accession: PF03458.17 Description: Glycine transporter Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.9e-49 150.5 29.8 8.9e-29 85.6 7.1 2.6 3 VIMSS7740322 Domain annotation for each sequence (and alignments): >> VIMSS7740322 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 85.6 7.1 8.9e-29 8.9e-29 1 76 [. 4 78 .. 4 80 .. 0.96 2 ! 74.0 10.8 3.6e-25 3.6e-25 2 75 .. 92 163 .. 91 166 .. 0.95 3 ? -0.7 0.2 0.071 0.071 14 34 .. 166 186 .. 160 191 .. 0.61 Alignments for each domain: == domain 1 score: 85.6 bits; conditional E-value: 8.9e-29 Gly_transporter 1 lvldaiGlaafavsGalkAlrkgldlfgvvvlGvvTavgGGvlRDvllgrevPvvllreplyalaallgallvvll 76 ++ld++G+a+fa+sG+l A + ++d+fgv+vlGvvTavgGG++RD+ l++ P++++r+p+ +++a++++ll+++l VIMSS7740322 4 YWLDILGTAVFAISGVLLAGKLRMDPFGVLVLGVVTAVGGGTIRDMALDN-GPAFWVRDPTDLVVAMVTCLLTIAL 78 59***********************************************6.9*********************987 PP == domain 2 score: 74.0 bits; conditional E-value: 3.6e-25 Gly_transporter 2 vldaiGlaafavsGalkAlrkgldlfgvvvlGvvTavgGGvlRDvllgrevPvvllreplyalaallgallvvl 75 vldaiGla+f +G+ kA ++ ++++v++Gv+T+vgGG++RDvl++ e+P++l +e +ya+a+++g+++ v VIMSS7740322 92 VLDAIGLAVFVGIGVNKAFAASAGPMIAVCMGVITGVGGGIIRDVLAR-EIPMILRTE-IYATACIIGGIVHVT 163 79**********************************************.7*****777.***********9876 PP == domain 3 score: -0.7 bits; conditional E-value: 0.071 Gly_transporter 14 sGalkAlrkgldlfgvvvlGv 34 + +Al++ + l ++++lG+ VIMSS7740322 166 VTFGMALQHAMMLGMAITLGI 186 444556666666666666665 PP
Or compare VIMSS7740322 to CDD or PaperBLAST