WP_002852232.1 has 210 amino acids
Query: Gly_transporter [M=78] Accession: PF03458.17 Description: Glycine transporter Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-47 146.0 20.8 1.2e-26 78.8 3.0 2.4 2 WP_002852232.1 Domain annotation for each sequence (and alignments): >> WP_002852232.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 78.8 3.0 1.2e-26 1.2e-26 3 73 .. 11 80 .. 9 84 .. 0.94 2 ! 74.5 8.2 2.5e-25 2.5e-25 2 75 .. 96 167 .. 95 170 .. 0.94 Alignments for each domain: == domain 1 score: 78.8 bits; conditional E-value: 1.2e-26 Gly_transporter 3 ldaiGlaafavsGalkAlrkgldlfgvvvlGvvTavgGGvlRDvllgrevPvvllreplyalaallgallv 73 l +iG+ a ++Gal+A r+++dlfgv+++++vTa+gGG +RDvllg+ +P+ ++++p y++++++ al++ WP_002852232.1 11 LYIIGISAEGMTGALAAGRHKMDLFGVIFIALVTAIGGGSIRDVLLGH-YPLTWVKHPEYIILICFCALVA 80 789********************************************6.***********99999888876 PP == domain 2 score: 74.5 bits; conditional E-value: 2.5e-25 Gly_transporter 2 vldaiGlaafavsGalkAlrkgldlfgvvvlGvvTavgGGvlRDvllgrevPvvllreplyalaallgallvvl 75 +ldaiGl++f++ Ga++A+++++ ++++v +v+T+v+GG+lRD+l+ r +P+v+ +e +ya +a++++++++ WP_002852232.1 96 TLDAIGLVVFSILGAQIAIDQNHGFIIAVAAAVITGVFGGILRDILCMR-IPLVFQKE-IYAGIAIIAGAIYYS 167 69**********************************************5.*****777.**********99985 PP
Or compare WP_002852232.1 to CDD or PaperBLAST