WP_005297863.1 has 204 amino acids
Query: Gly_transporter [M=78] Accession: PF03458.17 Description: Glycine transporter Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.1e-40 121.9 13.4 3.7e-22 64.3 1.9 2.3 2 WP_005297863.1 Domain annotation for each sequence (and alignments): >> WP_005297863.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 64.3 1.9 3.7e-22 3.7e-22 2 76 .. 5 78 .. 4 80 .. 0.96 2 ! 62.9 4.0 1e-21 1e-21 2 77 .. 93 166 .. 92 167 .. 0.95 Alignments for each domain: == domain 1 score: 64.3 bits; conditional E-value: 3.7e-22 Gly_transporter 2 vldaiGlaafavsGalkAlrkgldlfgvvvlGvvTavgGGvlRDvllgrevPvvllreplyalaallgallvvll 76 ++++i + afa+s ++ +++g d++ v+vlG+vTa+gGG++RDv+l + v+++++p y +aal+ +l+ +++ WP_005297863.1 5 IIELICICAFALSAVISEANRGKDIISVLVLGWVTALGGGTVRDVILST-DQVFWIKDPSYFWAALISSLIGFFI 78 789*********************************************6.8********************9987 PP == domain 2 score: 62.9 bits; conditional E-value: 1e-21 Gly_transporter 2 vldaiGlaafavsGalkAlrkgldlfgvvvlGvvTavgGGvlRDvllgrevPvvllreplyalaallgallvvlla 77 vldaiG+ +f+v + +++++ + +++++G+vTav+GGv+RD++++r P+++ + ++ya++++lg++l+v+++ WP_005297863.1 93 VLDAIGISMFSVLVTKNMIHQDYAAYVAITMGMVTAVFGGVVRDIIVNR--PTMFNNTEFYATPVILGCTLFVVFS 166 89**********************************************6..99998867**************996 PP
Or compare WP_005297863.1 to CDD or PaperBLAST