WP_006496215.1 has 203 amino acids
Query: Gly_transporter [M=78]
Accession: PF03458.17
Description: Glycine transporter
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
8e-45 137.0 25.0 5.6e-25 73.4 6.4 2.5 3 WP_006496215.1
Domain annotation for each sequence (and alignments):
>> WP_006496215.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 73.0 6.6 7.3e-25 7.3e-25 3 75 .. 4 75 .. 2 78 .. 0.94
2 ! 73.4 6.4 5.6e-25 5.6e-25 2 77 .. 89 162 .. 88 163 .. 0.94
3 ? -2.3 0.1 0.23 0.23 16 26 .. 172 182 .. 166 191 .. 0.62
Alignments for each domain:
== domain 1 score: 73.0 bits; conditional E-value: 7.3e-25
Gly_transporter 3 ldaiGlaafavsGalkAlrkgldlfgvvvlGvvTavgGGvlRDvllgrevPvvllreplyalaallgallvvl 75
l +i+++a a+sGal+++r+g+d fg +++G vTa+gGG++RDvllg+ +P+ ++ +p y++++l++a+++ +
WP_006496215.1 4 LYLIAIVAEAMSGALMGMRRGMDRFGLALVGAVTALGGGTVRDVLLGH-YPLGWIAHPEYLVITLVAATVASW 75
779********************************************6.*******************99866 PP
== domain 2 score: 73.4 bits; conditional E-value: 5.6e-25
Gly_transporter 2 vldaiGlaafavsGalkAlrkgldlfgvvvlGvvTavgGGvlRDvllgrevPvvllreplyalaallgallvvlla 77
++da+Glaaf+++G+ ++++ g +++vv+ G +T+v GG+lRD+l++ e+P++l re+lya++a++++ l+v ++
WP_006496215.1 89 TVDAVGLAAFTIIGCDVGASTGTAPIIVVLAGAITGVCGGMLRDLLCN-EMPLIL-REELYASVAFVTGSLYVGMQ 162
58**********************************************.7*****.555*************9876 PP
== domain 3 score: -2.3 bits; conditional E-value: 0.23
Gly_transporter 16 alkAlrkgldl 26
+l+Al++g+++
WP_006496215.1 172 TLVALAAGFSI 182
55666666665 PP
Or compare WP_006496215.1 to CDD or PaperBLAST