PaperBLAST – Find papers about a protein or its homologs

 

Align reanno::MR1:200494 to PF03458 (Gly_transporter)

reanno::MR1:200494 has 208 amino acids

Query:       Gly_transporter  [M=78]
Accession:   PF03458.17
Description: Glycine transporter
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence           Description
    ------- ------ -----    ------- ------ -----   ---- --  --------           -----------
    1.3e-52  162.0  26.1    6.4e-30   89.2   7.2    2.5  3  reanno::MR1:200494  


Domain annotation for each sequence (and alignments):
>> reanno::MR1:200494  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   89.2   7.2   6.4e-30   6.4e-30       2      76 ..       7      80 ..       6      82 .. 0.96
   2 !   80.5   8.8   3.4e-27   3.4e-27       2      75 ..      94     165 ..      93     168 .. 0.94
   3 ?   -0.2   0.1     0.051     0.051      14      38 ..     161     185 ..     159     186 .. 0.83

  Alignments for each domain:
  == domain 1  score: 89.2 bits;  conditional E-value: 6.4e-30
     Gly_transporter  2 vldaiGlaafavsGalkAlrkgldlfgvvvlGvvTavgGGvlRDvllgrevPvvllreplyalaallgallvvll 76
                        ++d++G+a+fa+sGal+A r+++d+fgv+vl+ vTavgGG +RD l+g+ +Pv+++r+p y++++l+++++++ll
  reanno::MR1:200494  7 FFDLCGTAVFALSGALAAGRHRMDPFGVIVLASVTAVGGGSIRDALIGA-TPVFWIRDPNYIIVILATVVACLLL 80
                        79**********************************************6.*******************999987 PP

  == domain 2  score: 80.5 bits;  conditional E-value: 3.4e-27
     Gly_transporter   2 vldaiGlaafavsGalkAlrkgldlfgvvvlGvvTavgGGvlRDvllgrevPvvllreplyalaallgallvvl 75 
                         v+da+Gla+f+v+Ga kAl++gl+ +++vv+G++T+vgGG++RD+l++ ++P+vl +e +ya+a+++g++ + +
  reanno::MR1:200494  94 VADALGLALFTVIGAEKALNMGLSGMIAVVMGLITGVGGGIIRDLLCR-QIPMVLRTE-IYATASIIGGIGYTV 165
                         68**********************************************.5*****777.**********98865 PP

  == domain 3  score: -0.2 bits;  conditional E-value: 0.051
     Gly_transporter  14 sGalkAlrkgldlfgvvvlGvvTav 38 
                         +G ++ l+ g+   ++++l++++a+
  reanno::MR1:200494 161 IGYTVSLACGMGEKTALFLAMASAL 185
                         5788888889999999999999986 PP



Or compare reanno::MR1:200494 to CDD or PaperBLAST