reanno::MR1:200494 has 208 amino acids
Query: Gly_transporter [M=78] Accession: PF03458.17 Description: Glycine transporter Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-52 162.0 26.1 6.4e-30 89.2 7.2 2.5 3 reanno::MR1:200494 Domain annotation for each sequence (and alignments): >> reanno::MR1:200494 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 89.2 7.2 6.4e-30 6.4e-30 2 76 .. 7 80 .. 6 82 .. 0.96 2 ! 80.5 8.8 3.4e-27 3.4e-27 2 75 .. 94 165 .. 93 168 .. 0.94 3 ? -0.2 0.1 0.051 0.051 14 38 .. 161 185 .. 159 186 .. 0.83 Alignments for each domain: == domain 1 score: 89.2 bits; conditional E-value: 6.4e-30 Gly_transporter 2 vldaiGlaafavsGalkAlrkgldlfgvvvlGvvTavgGGvlRDvllgrevPvvllreplyalaallgallvvll 76 ++d++G+a+fa+sGal+A r+++d+fgv+vl+ vTavgGG +RD l+g+ +Pv+++r+p y++++l+++++++ll reanno::MR1:200494 7 FFDLCGTAVFALSGALAAGRHRMDPFGVIVLASVTAVGGGSIRDALIGA-TPVFWIRDPNYIIVILATVVACLLL 80 79**********************************************6.*******************999987 PP == domain 2 score: 80.5 bits; conditional E-value: 3.4e-27 Gly_transporter 2 vldaiGlaafavsGalkAlrkgldlfgvvvlGvvTavgGGvlRDvllgrevPvvllreplyalaallgallvvl 75 v+da+Gla+f+v+Ga kAl++gl+ +++vv+G++T+vgGG++RD+l++ ++P+vl +e +ya+a+++g++ + + reanno::MR1:200494 94 VADALGLALFTVIGAEKALNMGLSGMIAVVMGLITGVGGGIIRDLLCR-QIPMVLRTE-IYATASIIGGIGYTV 165 68**********************************************.5*****777.**********98865 PP == domain 3 score: -0.2 bits; conditional E-value: 0.051 Gly_transporter 14 sGalkAlrkgldlfgvvvlGvvTav 38 +G ++ l+ g+ ++++l++++a+ reanno::MR1:200494 161 IGYTVSLACGMGEKTALFLAMASAL 185 5788888889999999999999986 PP
Or compare reanno::MR1:200494 to CDD or PaperBLAST