reanno::Phaeo:GFF90 has 207 amino acids
Query: Gly_transporter [M=78]
Accession: PF03458.17
Description: Glycine transporter
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.8e-41 126.2 28.1 3.9e-26 77.1 7.6 2.4 3 reanno::Phaeo:GFF90
Domain annotation for each sequence (and alignments):
>> reanno::Phaeo:GFF90
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 77.1 7.6 3.9e-26 3.9e-26 2 77 .. 6 80 .. 5 81 .. 0.93
2 ! 59.4 8.0 1.3e-20 1.3e-20 2 75 .. 92 164 .. 91 167 .. 0.95
3 ? -3.3 0.1 0.48 0.48 66 74 .. 176 184 .. 173 187 .. 0.44
Alignments for each domain:
== domain 1 score: 77.1 bits; conditional E-value: 3.9e-26
Gly_transporter 2 vldaiGlaafavsGalkAlrkgldlfgvvvlGvvTavgGGvlRDvllgrevPvvllreplyalaallgallvvlla 77
+ld++ +++fa+sGal+A r++ld++g+++++++TavgGG++RD+ll+r +Pv+++ +++ +l+a+++a+lv+++a
reanno::Phaeo:GFF90 6 LLDYASVLVFAASGALVASRAQLDIVGFAFVACLTAVGGGTVRDLLLDR-HPVFWIGDSTNILLAAAAAVLVFFTA 80
79**********************************************5.9******9888999999999998875 PP
== domain 2 score: 59.4 bits; conditional E-value: 1.3e-20
Gly_transporter 2 vldaiGlaafavsGalkAlrkgldlfgvvvlGvvTavgGGvlRDvllgrevPvvllreplyalaallgallvvl 75
+ld ++la+ +G+ +A+ g ++++vv++G++T++ GG++RDv+++ evP+vl + +ly+++a++ga+++v+
reanno::Phaeo:GFF90 92 WLDSFALAVAVSAGTGAAILTGQPPVIVVLMGMATGTLGGLMRDVVCN-EVPLVLKQGELYISCAMAGAITAVV 164
99**********************************************.7*****9967***********9986 PP
== domain 3 score: -3.3 bits; conditional E-value: 0.48
Gly_transporter 66 allgallvv 74
++ a++++
reanno::Phaeo:GFF90 176 LVACAVVCW 184
333334443 PP
Or compare reanno::Phaeo:GFF90 to CDD or PaperBLAST