reanno::WCS417:GFF481 has 204 amino acids
Query: Gly_transporter [M=78] Accession: PF03458.17 Description: Glycine transporter Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-49 152.5 19.9 2.4e-27 81.0 5.2 2.1 2 reanno::WCS417:GFF481 Domain annotation for each sequence (and alignments): >> reanno::WCS417:GFF481 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 81.0 5.2 2.4e-27 2.4e-27 2 77 .. 4 78 .. 3 79 .. 0.95 2 ! 77.7 6.7 2.6e-26 2.6e-26 2 76 .. 90 162 .. 89 164 .. 0.96 Alignments for each domain: == domain 1 score: 81.0 bits; conditional E-value: 2.4e-27 Gly_transporter 2 vldaiGlaafavsGalkAlrkgldlfgvvvlGvvTavgGGvlRDvllgrevPvvllreplyalaallgallvvlla 77 +l +i++ a a++Gal A r+g+d+fgvv++++vTa+gGG +RDvllg+ +P+ ++++p y++++ ++al+++++a reanno::WCS417:GFF481 4 MLYLIAITAEAMTGALSAGRRGMDWFGVVLIACVTALGGGSVRDVLLGH-YPLTWVKHPEYLVLTSIAALVTIFIA 78 6789********************************************6.**********************9975 PP == domain 2 score: 77.7 bits; conditional E-value: 2.6e-26 Gly_transporter 2 vldaiGlaafavsGalkAlrkgldlfgvvvlGvvTavgGGvlRDvllgrevPvvllreplyalaallgallvvll 76 +lda+Gl+af+++G+++Al++g+ ++++ v Gv+T+v+GG+lRD++++ ++P+++ re lya++++l+a++++l+ reanno::WCS417:GFF481 90 ALDAVGLVAFTLIGCMTALEMGHGMLVASVSGVITGVFGGILRDIFCN-DIPLIFRRE-LYASVSFLAAWFYMLC 162 69**********************************************.5*****888.*************997 PP
Or compare reanno::WCS417:GFF481 to CDD or PaperBLAST