PaperBLAST – Find papers about a protein or its homologs

 

Align reanno::psRCH2:GFF1599 to PF03458 (Gly_transporter)

reanno::psRCH2:GFF1599 has 208 amino acids

Query:       Gly_transporter  [M=78]
Accession:   PF03458.17
Description: Glycine transporter
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence               Description
    ------- ------ -----    ------- ------ -----   ---- --  --------               -----------
    1.4e-45  139.4  27.4    3.6e-25   74.0   7.8    2.5  3  reanno::psRCH2:GFF1599  


Domain annotation for each sequence (and alignments):
>> reanno::psRCH2:GFF1599  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   74.0   7.8   3.6e-25   3.6e-25       3      76 ..       7      79 ..       5      81 .. 0.94
   2 !   72.8   9.6   8.2e-25   8.2e-25       2      76 ..      92     164 ..      91     166 .. 0.95
   3 ?   -1.4   0.1      0.12      0.12      56      73 ..     166     184 ..     161     189 .. 0.61

  Alignments for each domain:
  == domain 1  score: 74.0 bits;  conditional E-value: 3.6e-25
         Gly_transporter  3 ldaiGlaafavsGalkAlrkgldlfgvvvlGvvTavgGGvlRDvllgrevPvvllreplyalaallgallvvll 76
                            + +i++ a a+sGa++++r+g+dlfg+++lG+vTa+gGG+ RDvllg+ +Pv ++ +p y++ ++ +a+++ ++
  reanno::psRCH2:GFF1599  7 IYLIAITAEAMSGAIMGMRRGMDLFGICLLGTVTALGGGTARDVLLGH-YPVGWIAHPEYLTFTIGAAIVTGFI 79
                            6789*******************************************6.********************99776 PP

  == domain 2  score: 72.8 bits;  conditional E-value: 8.2e-25
         Gly_transporter   2 vldaiGlaafavsGalkAlrkgldlfgvvvlGvvTavgGGvlRDvllgrevPvvllreplyalaallgallvvll 76 
                             ++d +Gl+af+v+G+ +A+ +g ++ +vv+ Gv+T+++GG++RDvl++ +vP+vl re lya++al++++++v +
  reanno::psRCH2:GFF1599  92 LVDGLGLVAFTVIGCDVAMGMGAHPSIVVLAGVITGIFGGLMRDVLCN-QVPMVLQRE-LYATVALFTGVFYVGM 164
                             6899********************************************.5*****888.*************976 PP

  == domain 3  score: -1.4 bits;  conditional E-value: 0.12
         Gly_transporter  56 llr.eplyalaallgallv 73 
                             +l+ +++ a++a+lg+ + 
  reanno::psRCH2:GFF1599 166 WLEiNTTLATLAALGSGFL 184
                             5555556666666666554 PP



Or compare reanno::psRCH2:GFF1599 to CDD or PaperBLAST