reanno::pseudo13_GW456_L13:PfGW456L13_161 has 203 amino acids
Query: Gly_transporter [M=78] Accession: PF03458.17 Description: Glycine transporter Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.1e-49 149.8 20.7 1e-26 79.0 5.9 2.2 2 reanno::pseudo13_GW456_L13:PfGW456L13_161 Domain annotation for each sequence (and alignments): >> reanno::pseudo13_GW456_L13:PfGW456L13_161 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 79.0 5.9 1e-26 1e-26 2 77 .. 4 78 .. 3 79 .. 0.95 2 ! 76.9 6.9 4.6e-26 4.6e-26 2 76 .. 90 162 .. 89 164 .. 0.96 Alignments for each domain: == domain 1 score: 79.0 bits; conditional E-value: 1e-26 Gly_transporter 2 vldaiGlaafavsGalkAlrkgldlfgvvvlGvvTavgGGvlRDvllgrevPvvllreplyalaallgal 71 +l +i++ a++Gal A r+g+d+fgvv++++vTa+gGG +RDvllg+ +P+ ++++p y++++ ++a+ reanno::pseudo13_GW456_L13:PfGW456L13_161 4 MLYLIAITTEAMTGALSAGRRGMDWFGVVLIACVTALGGGSVRDVLLGH-YPLTWVKHPEYLVLTTAAAM 72 67899*******************************************6.******************** PP Gly_transporter 72 lvvlla 77 ++v++a reanno::pseudo13_GW456_L13:PfGW456L13_161 73 ITVFTA 78 **9975 PP == domain 2 score: 76.9 bits; conditional E-value: 4.6e-26 Gly_transporter 2 vldaiGlaafavsGalkAlrkgldlfgvvvlGvvTavgGGvlRDvllgrevPvvllreplyalaallg 69 vlda+Gl+af+++G+++Al++g+ ++++ v Gv+T+v+GG+lRD++++ ++P+++ re lya++++++ reanno::pseudo13_GW456_L13:PfGW456L13_161 90 VLDAMGLVAFTLIGCITALEMGHGMLVASVSGVITGVFGGILRDIFCN-DIPLIFRRE-LYASVSFAA 155 89**********************************************.5*****888.********* PP Gly_transporter 70 allvvll 76 a++++l+ reanno::pseudo13_GW456_L13:PfGW456L13_161 156 AWCYMLC 162 ****987 PP
Or compare reanno::pseudo13_GW456_L13:PfGW456L13_161 to CDD or PaperBLAST