reanno::pseudo3_N2E3:AO353_13110 has 203 amino acids
Query: Gly_transporter [M=78] Accession: PF03458.17 Description: Glycine transporter Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-49 152.1 20.0 4e-27 80.3 5.3 2.2 2 reanno::pseudo3_N2E3:AO353_13110 Domain annotation for each sequence (and alignments): >> reanno::pseudo3_N2E3:AO353_13110 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 80.3 5.3 4e-27 4e-27 2 77 .. 4 78 .. 3 79 .. 0.95 2 ! 77.9 6.8 2.2e-26 2.2e-26 2 76 .. 90 162 .. 89 164 .. 0.96 Alignments for each domain: == domain 1 score: 80.3 bits; conditional E-value: 4e-27 Gly_transporter 2 vldaiGlaafavsGalkAlrkgldlfgvvvlGvvTavgGGvlRDvllgrevPvvllreplyalaallgallvvlla 77 +l +i++ a a++Gal A r+g+d+fgvv++++vTa+gGG +RDvllg+ +P+ ++++p y++++ ++a+l+v++a reanno::pseudo3_N2E3:AO353_13110 4 MLYLIAITAEAMTGALSAGRRGMDWFGVVLIACVTALGGGSVRDVLLGH-YPLTWVKHPEYLVLTSAAAMLTVFTA 78 6789********************************************6.********************999975 PP == domain 2 score: 77.9 bits; conditional E-value: 2.2e-26 Gly_transporter 2 vldaiGlaafavsGalkAlrkgldlfgvvvlGvvTavgGGvlRDvllgrevPvvllreplyalaallgallvvll 76 vlda+Gl+af+++G+++Al+ g+ ++++ v Gv+T+v+GG+lRD++++ ++P+++ re lya++++++a++++l+ reanno::pseudo3_N2E3:AO353_13110 90 VLDAVGLVAFTLIGCMIALETGHGMLVASVSGVITGVFGGILRDIFCN-DIPLIFRRE-LYASVSFAAAWCYMLC 162 89**********************************************.5*****888.*************997 PP
Or compare reanno::pseudo3_N2E3:AO353_13110 to CDD or PaperBLAST