reanno::pseudo6_N2E2:Pf6N2E2_3621 has 203 amino acids
Query: Gly_transporter [M=78] Accession: PF03458.17 Description: Glycine transporter Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-49 152.1 20.9 2e-27 81.2 6.0 2.2 2 reanno::pseudo6_N2E2:Pf6N2E2_3621 Domain annotation for each sequence (and alignments): >> reanno::pseudo6_N2E2:Pf6N2E2_3621 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 81.2 6.0 2e-27 2e-27 2 77 .. 4 78 .. 3 79 .. 0.96 2 ! 76.8 7.0 4.8e-26 4.8e-26 2 76 .. 90 162 .. 89 163 .. 0.96 Alignments for each domain: == domain 1 score: 81.2 bits; conditional E-value: 2e-27 Gly_transporter 2 vldaiGlaafavsGalkAlrkgldlfgvvvlGvvTavgGGvlRDvllgrevPvvllreplyalaallgallvvlla 77 +l +i++ a a++Gal A r+g+d+fgvv++++vTa+gGG +RDvllg+ +P+ ++++p y++++ ++a+l+v+la reanno::pseudo6_N2E2:Pf6N2E2_3621 4 MLYLIAITAEAMTGALSAGRRGMDWFGVVLIACVTALGGGSVRDVLLGH-YPLTWVKHPEYLVLTTAAAMLTVFLA 78 6789********************************************6.***********************986 PP == domain 2 score: 76.8 bits; conditional E-value: 4.8e-26 Gly_transporter 2 vldaiGlaafavsGalkAlrkgldlfgvvvlGvvTavgGGvlRDvllgrevPvvllreplyalaallgallvvll 76 vlda+Gl+af+++G+++Al++g+ ++++ v Gv+T+v+GG+lRD++++ ++P+++ re lya++++++a++++l+ reanno::pseudo6_N2E2:Pf6N2E2_3621 90 VLDAAGLVAFTLIGCMTALEMGHGMLVASVSGVITGVFGGILRDIFCN-DIPLIFRRE-LYASVSFAAAWCYLLC 162 89**********************************************.5*****888.*************986 PP
Or compare reanno::pseudo6_N2E2:Pf6N2E2_3621 to CDD or PaperBLAST