PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10084901 to PF03478 (DUF295)

VIMSS10084901 has 371 amino acids

Query:       DUF295  [M=55]
Accession:   PF03478.18
Description: Protein of unknown function (DUF295)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
    1.9e-13   36.2   0.1    5.2e-13   34.7   0.1    1.8  1  VIMSS10084901  


Domain annotation for each sequence (and alignments):
>> VIMSS10084901  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   34.7   0.1   5.2e-13   5.2e-13       1      41 [.     298     337 ..     298     356 .. 0.84

  Alignments for each domain:
  == domain 1  score: 34.7 bits;  conditional E-value: 5.2e-13
         DUF295   1 eevksLGdraLFlGrnssfsvsasdfgglkgNcIYFttddd 41 
                    +evk+LGd a+    + +fsv a ++ g+ +N+IYF+ +d 
  VIMSS10084901 298 VEVKTLGDNAFVMATDTCFSVLAHEYYGCLPNSIYFI-EDL 337
                    79************************77********6.333 PP



Or compare VIMSS10084901 to CDD or PaperBLAST