PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10085296 to PF03478 (DUF295)

VIMSS10085296 has 401 amino acids

Query:       DUF295  [M=55]
Accession:   PF03478.18
Description: Protein of unknown function (DUF295)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
    1.1e-13   37.0   0.1    2.3e-13   35.9   0.1    1.6  1  VIMSS10085296  


Domain annotation for each sequence (and alignments):
>> VIMSS10085296  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   35.9   0.1   2.3e-13   2.3e-13       1      55 []     318     370 ..     318     370 .. 0.90

  Alignments for each domain:
  == domain 1  score: 35.9 bits;  conditional E-value: 2.3e-13
         DUF295   1 eevksLGdraLFlGrnssfsvsasdfgglkgNcIYFttdddeekdegrdigVYdl 55 
                    ee+ sLGd++++lG +    v a+d++g+  N+IYFt dd +e++e+++i++Y+l
  VIMSS10085296 318 EEIVSLGDESILLGLG--ITVLAKDMEGITCNSIYFTADDFYEDYEENEIFIYNL 370
                    6889************..889*****88********7666666***********7 PP



Or compare VIMSS10085296 to CDD or PaperBLAST