PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10110071 to PF03478 (DUF295)

VIMSS10110071 has 365 amino acids

Query:       DUF295  [M=55]
Accession:   PF03478.18
Description: Protein of unknown function (DUF295)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
    1.4e-14   39.7   0.2    3.9e-14   38.3   0.2    1.8  1  VIMSS10110071  


Domain annotation for each sequence (and alignments):
>> VIMSS10110071  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   38.3   0.2   3.9e-14   3.9e-14       3      42 ..     289     327 ..     288     343 .. 0.83

  Alignments for each domain:
  == domain 1  score: 38.3 bits;  conditional E-value: 3.9e-14
         DUF295   3 vksLGdraLFlGrnssfsvsasdfgglkgNcIYFttddde 42 
                    ++++Gd ++FlG++ +f+v as ++glk+N+IY++ ++++
  VIMSS10110071 289 TEDIGDLCIFLGKSEAFCVTASLYPGLKPNSIYYL-GPRF 327
                    68**********************99********5.4442 PP



Or compare VIMSS10110071 to CDD or PaperBLAST