PaperBLAST – Find papers about a protein or its homologs

 

Align NP_173514.1 to PF03479 (DUF296)

NP_173514.1 has 311 amino acids

Query:       DUF296  [M=107]
Accession:   PF03479.15
Description: Plants and Prokaryotes Conserved (PCC) domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    3.8e-31   94.0   0.4    5.1e-31   93.6   0.4    1.2  1  NP_173514.1  


Domain annotation for each sequence (and alignments):
>> NP_173514.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   93.6   0.4   5.1e-31   5.1e-31       1     107 []     114     236 ..     114     236 .. 0.90

  Alignments for each domain:
  == domain 1  score: 93.6 bits;  conditional E-value: 5.1e-31
                  TEEEEEE-TTSBHHHHHHHHHHHHT-SSEEEEEEEEEEEEEE..EEECTTT..............EE-S-EEEEEEEEEEEE.......TTEEEEEEE CS
       DUF296   1 rphvlrlepGediveaieefarkrgiraacvlsaiGavsnvt..rladgee..............kllgrfeilslsGtilp.......dglHlhvsl 75 
                  r hvl+++pG dive+++++ar+r  r+++vl ++G+vsnvt  +     +              +l grfeilsl+Gt+lp       +g  l++ l
  NP_173514.1 114 RSHVLEVSPGADIVESVSTYARRR-GRGVSVLGGNGTVSNVTlrQ-PV--TpgngggvsggggvvTLHGRFEILSLTGTVLPppappgaGG--LSIFL 205
                  68**********************.*****************632.32..233578888888877777*******************9999..***** PP

                  EETTSEEEEEEEEEE.EEEEEEEEEEEEE-CS CS
       DUF296  76 agedgqvvgGhlaegplvaattvevvvaefeg 107
                  ag++gqvvgG ++ +pl+a+++v +++a+f++
  NP_173514.1 206 AGGQGQVVGGSVV-APLIASAPVILMAASFSN 236
                  *************.99*************985 PP



Or compare NP_173514.1 to CDD or PaperBLAST