PaperBLAST – Find papers about a protein or its homologs

 

Align NP_177776.1 to PF03479 (DUF296)

NP_177776.1 has 302 amino acids

Query:       DUF296  [M=107]
Accession:   PF03479.15
Description: Plants and Prokaryotes Conserved (PCC) domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    2.4e-30   91.4   0.6    3.1e-30   91.0   0.6    1.1  1  NP_177776.1  


Domain annotation for each sequence (and alignments):
>> NP_177776.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   91.0   0.6   3.1e-30   3.1e-30       1     107 []     100     222 ..     100     222 .. 0.88

  Alignments for each domain:
  == domain 1  score: 91.0 bits;  conditional E-value: 3.1e-30
                  TEEEEEE-TTSBHHHHHHHHHHHHT-SSEEEEEEEEEEEEEE..EEECTTT...............EE-S-EEEEEEEEEEEE.......TTEEEEEE CS
       DUF296   1 rphvlrlepGediveaieefarkrgiraacvlsaiGavsnvt..rladgee...............kllgrfeilslsGtilp.......dglHlhvs 74 
                  r hvl+++ G dive+++++ar+r  r++++ls++G+v+nv+  +    ++                l grfeilsl+Gt+lp       +g  l++ 
  NP_177776.1 100 RSHVLEVSSGADIVESVTTYARRR-GRGVSILSGNGTVANVSlrQ----PAttaahganggtggvvALHGRFEILSLTGTVLPppappgsGG--LSIF 190
                  68**********************.*****************532....22233455667666665555*******************9988..**** PP

                  EEETTSEEEEEEEEEE.EEEEEEEEEEEEE-CS CS
       DUF296  75 lagedgqvvgGhlaegplvaattvevvvaefeg 107
                  l+g +gqv+gG+++ +plva+++v +++a+f++
  NP_177776.1 191 LSGVQGQVIGGNVV-APLVASGPVILMAASFSN 222
                  ***99*********.99*************985 PP



Or compare NP_177776.1 to CDD or PaperBLAST