PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::O49662 to PF03479 (DUF296)

SwissProt::O49662 has 324 amino acids

Query:       DUF296  [M=107]
Accession:   PF03479.15
Description: Plants and Prokaryotes Conserved (PCC) domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    1.1e-33  102.2   0.1    1.5e-33  101.6   0.1    1.2  1  SwissProt::O49662  


Domain annotation for each sequence (and alignments):
>> SwissProt::O49662  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  101.6   0.1   1.5e-33   1.5e-33       1     107 []     133     249 ..     133     249 .. 0.91

  Alignments for each domain:
  == domain 1  score: 101.6 bits;  conditional E-value: 1.5e-33
                        TEEEEEE-TTSBHHHHHHHHHHHHT-SSEEEEEEEEEEEEEEEEECTTT.........EE-S-EEEEEEEEEEEE.......TTEEEEEEEE CS
             DUF296   1 rphvlrlepGediveaieefarkrgiraacvlsaiGavsnvtrladgee.........kllgrfeilslsGtilp.......dglHlhvsla 76 
                        r+hv+++ +G+d+ve++++far+r +r++cv+s++G v+nvt  + ++          +l grfeilslsG++lp       +g  l+v+la
  SwissProt::O49662 133 RTHVMEIGDGCDLVESVATFARRR-QRGVCVMSGTGNVTNVT--IRQPGshpspgsvvSLHGRFEILSLSGSFLPppapptaTG--LSVYLA 219
                        79**********************.*****************..33333456788887777**************999998888..****** PP

                        ETTSEEEEEEEEEE.EEEEEEEEEEEEE-CS CS
             DUF296  77 gedgqvvgGhlaegplvaattvevvvaefeg 107
                        g++gqvvgG ++ gpl  a++v v++a+f++
  SwissProt::O49662 220 GGQGQVVGGSVV-GPLLCAGPVVVMAASFSN 249
                        ************.***************985 PP



Or compare SwissProt::O49662 to CDD or PaperBLAST