SwissProt::Q8GXB3 has 378 amino acids
Query: PCC [M=117] Accession: PF03479.19 Description: Plants and Prokaryotes Conserved (PCC) domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.6e-26 77.4 0.2 7.8e-26 77.0 0.2 1.2 1 SwissProt::Q8GXB3 Domain annotation for each sequence (and alignments): >> SwissProt::Q8GXB3 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 77.0 0.2 7.8e-26 7.8e-26 2 115 .. 179 291 .. 178 293 .. 0.93 Alignments for each domain: == domain 1 score: 77.0 bits; conditional E-value: 7.8e-26 PCC 2 vfvlrlepGedilesleefareegiraacvlsaiGavsnatlglvdgeekeyeekellgpfEilslsGtisp.........tdgepflHlhv 84 ++v+ + Gedi++++ +f++++ +ra c++s++G+vs++t + ++++++ + +++g+fEilsl G+++ t+g l+v SwissProt::Q8GXB3 179 PHVISVGSGEDIVSKVLSFSQKR-PRALCIMSGTGTVSSVT---LREPASTTPSLTFEGRFEILSLGGSYLVneeggsksrTGG-----LSV 261 79*********************.*****************...67777777789*****************888888777777.....*** PP PCC 85 sladedgqvvgGhlveglvaattvevviaef 115 sl++++g+v+gG + l+aa+ v+vv+++f SwissProt::Q8GXB3 262 SLSGPEGHVIGGGIG-MLIAASLVQVVACSF 291 **************8.8***********998 PP
Or compare SwissProt::Q8GXB3 to CDD or PaperBLAST