PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q9M9R4 to PF03479 (DUF296)

SwissProt::Q9M9R4 has 206 amino acids

Query:       DUF296  [M=107]
Accession:   PF03479.15
Description: Plants and Prokaryotes Conserved (PCC) domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    5.1e-28   83.9   0.0    6.4e-28   83.6   0.0    1.1  1  SwissProt::Q9M9R4  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q9M9R4  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   83.6   0.0   6.4e-28   6.4e-28       2     107 .]      32     151 ..      31     151 .. 0.90

  Alignments for each domain:
  == domain 1  score: 83.6 bits;  conditional E-value: 6.4e-28
                        EEEEEE-TTSBHHHHHHHHHHHHT-SSEEEEEEEEEEEEEE.EEECTTT........EE-S-EEEEEEEEEEEE............TTEEEE CS
             DUF296   2 phvlrlepGediveaieefarkrgiraacvlsaiGavsnvt.rladgee........kllgrfeilslsGtilp............dglHlh 72 
                        p++l+++ G+d+vea+++f+r +   + cvls++G+v++vt r     +        ++ g+f++ls+s+t+lp            +   ++
  SwissProt::Q9M9R4  32 PYILEVPSGNDVVEALNRFCRGK-AIGFCVLSGSGSVADVTlRQP---SpaapgstiTFHGKFDLLSVSATFLPplpptslsppvsN--FFT 117
                        89*********************.99***************5333...345588889999****************99988877743..6** PP

                        EEEEETTSEEEEEEEEEE.EEEEEEEEEEEEE-CS CS
             DUF296  73 vslagedgqvvgGhlaegplvaattvevvvaefeg 107
                        vslag++g+v+gG +a gplvaa+tv  v+++f++
  SwissProt::Q9M9R4 118 VSLAGPQGKVIGGFVA-GPLVAAGTVYFVATSFKN 151
                        ****************.***************985 PP



Or compare SwissProt::Q9M9R4 to CDD or PaperBLAST