VIMSS10080458 has 311 amino acids
Query: PCC [M=117] Accession: PF03479.19 Description: Plants and Prokaryotes Conserved (PCC) domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.8e-25 75.2 0.1 3.8e-25 74.7 0.1 1.2 1 VIMSS10080458 Domain annotation for each sequence (and alignments): >> VIMSS10080458 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 74.7 0.1 3.8e-25 3.8e-25 1 116 [. 114 235 .. 114 236 .. 0.93 Alignments for each domain: == domain 1 score: 74.7 bits; conditional E-value: 3.8e-25 PCC 1 rvfvlrlepGedilesleefareegiraacvlsaiGavsnatlglvdgeekeye......ekellgpfEilslsGtisp......tdgepflHlhv 84 r +vl+++pG di+es+ ++ar++ r+++vl ++G+vsn+tl+ ++ + +l g+fEilsl+Gt++p +g l++ VIMSS10080458 114 RSHVLEVSPGADIVESVSTYARRR-GRGVSVLGGNGTVSNVTLRQPVTPGNGGGvsggggVVTLHGRFEILSLTGTVLPppappgAGG-----LSI 203 68**********************.*****************99888888887788888888888*****************999889.....*** PP PCC 85 sladedgqvvgGhlveglvaattvevviaefe 116 la+ +gqvvgG +v l+a+++v +++a+f+ VIMSS10080458 204 FLAGGQGQVVGGSVVAPLIASAPVILMAASFS 235 ***************66************997 PP
Or compare VIMSS10080458 to CDD or PaperBLAST