VIMSS10086102 has 302 amino acids
Query: PCC [M=117] Accession: PF03479.19 Description: Plants and Prokaryotes Conserved (PCC) domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.6e-25 74.0 0.2 8.5e-25 73.6 0.2 1.1 1 VIMSS10086102 Domain annotation for each sequence (and alignments): >> VIMSS10086102 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 73.6 0.2 8.5e-25 8.5e-25 1 116 [. 100 221 .. 100 222 .. 0.89 Alignments for each domain: == domain 1 score: 73.6 bits; conditional E-value: 8.5e-25 PCC 1 rvfvlrlepGedilesleefareegiraacvlsaiGavsnatlglvdgeekeye......ekellgpfEilslsGtisp......tdgepflHlhv 84 r +vl+++ G di+es++++ar++ r++++ls++G+v+n++l+ +++ + l g+fEilsl+Gt++p ++g l++ VIMSS10086102 100 RSHVLEVSSGADIVESVTTYARRR-GRGVSILSGNGTVANVSLRQPATTAAHGAnggtggVVALHGRFEILSLTGTVLPppappgSGG-----LSI 189 68**********************.*****************66665555554466666666666******************99999.....*** PP PCC 85 sladedgqvvgGhlveglvaattvevviaefe 116 l++ +gqv+gG +v lva+++v +++a+f+ VIMSS10086102 190 FLSGVQGQVIGGNVVAPLVASGPVILMAASFS 221 ***************66************997 PP
Or compare VIMSS10086102 to CDD or PaperBLAST