PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10109406 to PF03479 (DUF296)

VIMSS10109406 has 276 amino acids

Query:       DUF296  [M=107]
Accession:   PF03479.15
Description: Plants and Prokaryotes Conserved (PCC) domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
    2.2e-30   91.5   0.0    3.3e-30   91.0   0.0    1.3  1  VIMSS10109406  


Domain annotation for each sequence (and alignments):
>> VIMSS10109406  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   91.0   0.0   3.3e-30   3.3e-30       2     107 .]      85     204 ..      84     204 .. 0.90

  Alignments for each domain:
  == domain 1  score: 91.0 bits;  conditional E-value: 3.3e-30
                    EEEEEE-TTSBHHHHHHHHHHHHT-SSEEEEEEEEEEEEEE.EEECTTT........EE-S-EEEEEEEEEEEE............TTEEEEEEEE CS
         DUF296   2 phvlrlepGediveaieefarkrgiraacvlsaiGavsnvt.rladgee........kllgrfeilslsGtilp............dglHlhvsla 76 
                    p++l+++ G+d+veai++f+r++   ++cvls++G+v+nvt r     +        ++ g+f++ls+s+t+lp            +   ++vsla
  VIMSS10109406  85 PYILEVPSGNDVVEAINRFCRRK-SIGVCVLSGSGSVANVTlRQP---SpaalgstiTFHGKFDLLSVSATFLPppprtslsppvsN--FFTVSLA 174
                    89*********************.99***************4333...345588888889**************9999888777643..6****** PP

                    ETTSEEEEEEEEEE.EEEEEEEEEEEEE-CS CS
         DUF296  77 gedgqvvgGhlaegplvaattvevvvaefeg 107
                    g++gq++gG +a gpl++a+tv v++a+f++
  VIMSS10109406 175 GPQGQIIGGFVA-GPLISAGTVYVIAASFNN 204
                    ************.****************85 PP



Or compare VIMSS10109406 to CDD or PaperBLAST