WP_005641953.1 has 185 amino acids
Query: PCC [M=117] Accession: PF03479.19 Description: Plants and Prokaryotes Conserved (PCC) domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-32 98.6 0.7 2.4e-32 98.0 0.1 1.6 2 WP_005641953.1 Domain annotation for each sequence (and alignments): >> WP_005641953.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.6 0.1 0.18 0.18 92 111 .. 12 32 .. 9 37 .. 0.69 2 ! 98.0 0.1 2.4e-32 2.4e-32 2 114 .. 53 163 .. 52 166 .. 0.96 Alignments for each domain: == domain 1 score: -1.6 bits; conditional E-value: 0.18 PCC 92 qvvgGhlveg.lvaattvevv 111 +v++Gh++++ l + v v WP_005641953.1 12 SVLMGHFIKKlLFILLFVGVL 32 589999998855555555555 PP == domain 2 score: 98.0 bits; conditional E-value: 2.4e-32 PCC 2 vfvlrlepGedilesleefareegiraacvlsaiGavsnatlglvdgeekeyeekellgpfEilslsGtisptdgepflHlhvsladedgqvvgG 96 +++ +++ +i+++l++f++e+gi ++++ ++iGa+ + tl++++ ++k y++k++ +++Ei +l+G+is ++++++lHlh++++++d ++++G WP_005641953.1 53 KYIVSINNHTEIVKALNAFCKEKGILSGSI-NGIGAIGELTLRFFNPKTKAYDDKTFREQMEISNLTGNISSMNEQVYLHLHITVGRSDYSALAG 146 5899**************************.******************************************999******************* PP PCC 97 hlveglvaattvevviae 114 hl++++ ++ e v+ WP_005641953.1 147 HLLSAIQ-NGAGEFVVED 163 ***8888.9*99999976 PP
Or compare WP_005641953.1 to CDD or PaperBLAST