PaperBLAST – Find papers about a protein or its homologs

 

Align WP_005641953.1 to PF03479 (PCC)

WP_005641953.1 has 185 amino acids

Query:       PCC  [M=117]
Accession:   PF03479.19
Description: Plants and Prokaryotes Conserved (PCC) domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    1.5e-32   98.6   0.7    2.4e-32   98.0   0.1    1.6  2  WP_005641953.1  


Domain annotation for each sequence (and alignments):
>> WP_005641953.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -1.6   0.1      0.18      0.18      92     111 ..      12      32 ..       9      37 .. 0.69
   2 !   98.0   0.1   2.4e-32   2.4e-32       2     114 ..      53     163 ..      52     166 .. 0.96

  Alignments for each domain:
  == domain 1  score: -1.6 bits;  conditional E-value: 0.18
             PCC  92 qvvgGhlveg.lvaattvevv 111
                     +v++Gh++++ l +   v v 
  WP_005641953.1  12 SVLMGHFIKKlLFILLFVGVL 32 
                     589999998855555555555 PP

  == domain 2  score: 98.0 bits;  conditional E-value: 2.4e-32
             PCC   2 vfvlrlepGedilesleefareegiraacvlsaiGavsnatlglvdgeekeyeekellgpfEilslsGtisptdgepflHlhvsladedgqvvgG 96 
                      +++ +++  +i+++l++f++e+gi ++++ ++iGa+ + tl++++ ++k y++k++ +++Ei +l+G+is ++++++lHlh++++++d ++++G
  WP_005641953.1  53 KYIVSINNHTEIVKALNAFCKEKGILSGSI-NGIGAIGELTLRFFNPKTKAYDDKTFREQMEISNLTGNISSMNEQVYLHLHITVGRSDYSALAG 146
                     5899**************************.******************************************999******************* PP

             PCC  97 hlveglvaattvevviae 114
                     hl++++   ++ e v+  
  WP_005641953.1 147 HLLSAIQ-NGAGEFVVED 163
                     ***8888.9*99999976 PP



Or compare WP_005641953.1 to CDD or PaperBLAST