PaperBLAST – Find papers about a protein or its homologs

 

Align WP_016265504.1 to PF03479 (PCC)

WP_016265504.1 has 140 amino acids

Query:       PCC  [M=117]
Accession:   PF03479.19
Description: Plants and Prokaryotes Conserved (PCC) domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    1.8e-29   88.7   0.1    2.3e-29   88.4   0.1    1.1  1  WP_016265504.1  


Domain annotation for each sequence (and alignments):
>> WP_016265504.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   88.4   0.1   2.3e-29   2.3e-29       2     113 ..       9     118 ..       8     121 .. 0.96

  Alignments for each domain:
  == domain 1  score: 88.4 bits;  conditional E-value: 2.3e-29
             PCC   2 vfvlrlepGedilesleefareegiraacvlsaiGavsnatlglvdgeekeyeekellgpfEilslsGtisptdgepflHlhvsladedgqvvgG 96 
                     ++++rle G++++++l+ +a++   + + + s+iGa++++t+++++ ++++y e++ ++++E+lslsG++ + dg+++ Hlh+s+a+ d +v+gG
  WP_016265504.1   9 QIICRLEVGDELITELKYLAATLPDQLGAI-SGIGACNDVTVSIYSPDSDSYVETRSQEQVELLSLSGNVENADGKISTHLHASFARLDTSVFGG 102
                     6899*******************9999999.**************************************************************** PP

             PCC  97 hlveglvaattvevvia 113
                     hl ++++ + t e+vi 
  WP_016265504.1 103 HLERAVI-SRTGELVIS 118
                     ***8888.*******97 PP



Or compare WP_016265504.1 to CDD or PaperBLAST