WP_035109938.1 has 139 amino acids
Query: PCC [M=117]
Accession: PF03479.19
Description: Plants and Prokaryotes Conserved (PCC) domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.8e-36 111.3 0.0 2.2e-36 111.0 0.0 1.0 1 WP_035109938.1
Domain annotation for each sequence (and alignments):
>> WP_035109938.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 111.0 0.0 2.2e-36 2.2e-36 3 113 .. 10 118 .. 8 121 .. 0.96
Alignments for each domain:
== domain 1 score: 111.0 bits; conditional E-value: 2.2e-36
PCC 3 fvlrlepGedilesleefareegiraacvlsaiGavsnatlglvdgeekeyeekellgpfEilslsGtisptdgepflHlhvsladedgqvvgGh 97
+++rl++G++i+es++ ++++e+i++a v s+iGa +++ +g+++ e+k+y+ek+++g+fEi+sl+G++s+ ++++++Hlh+ l+d+d +v gGh
WP_035109938.1 10 YLIRLDRGDEIIESIKVLCKKEDIKGAKV-SGIGATNQVVIGIYELENKKYNEKQFKGDFEITSLVGNVSTYKDNLIPHLHINLGDKDFNVKGGH 103
89***************************.*****************************************8888******************** PP
PCC 98 lveglvaattvevvia 113
l ++++ + t e+++
WP_035109938.1 104 LQSAII-SVTGEIFLE 118
**7777.******986 PP
Or compare WP_035109938.1 to CDD or PaperBLAST