WP_077076135.1 has 138 amino acids
Query: PCC [M=117] Accession: PF03479.19 Description: Plants and Prokaryotes Conserved (PCC) domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-30 92.4 0.0 1.4e-30 92.2 0.0 1.0 1 WP_077076135.1 Domain annotation for each sequence (and alignments): >> WP_077076135.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 92.2 0.0 1.4e-30 1.4e-30 3 114 .. 10 116 .. 8 119 .. 0.93 Alignments for each domain: == domain 1 score: 92.2 bits; conditional E-value: 1.4e-30 PCC 3 fvlrlepGedilesleefareegiraacvlsaiGavsnatlglvdgeekeyeekellgpfEilslsGtisptdgepflHlhvsladedgqvvgGh 97 ++++l++Gedi++sle+++ ee+i++++++s+iGa + ++g++ k+ye++ + p+Ei+s+sG+i++ g+p++H+h+ +a++d+ ++gGh WP_077076135.1 10 VIVKLDEGEDIIKSLEKVLVEENIKNGFIVSGIGAGVELEIGYLR--GKTYEREIFSPPMEITSFSGSITE--GDPKMHIHINAAGPDHVTYGGH 100 799****************************************97..77788999999************9..77******************** PP PCC 98 lveglvaattvevviae 114 l++g + +e+ + + WP_077076135.1 101 LFSGKA-KPLMEILLFS 116 **9955.7****99876 PP
Or compare WP_077076135.1 to CDD or PaperBLAST