PaperBLAST – Find papers about a protein or its homologs

 

Align WP_077076135.1 to PF03479 (PCC)

WP_077076135.1 has 138 amino acids

Query:       PCC  [M=117]
Accession:   PF03479.19
Description: Plants and Prokaryotes Conserved (PCC) domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    1.3e-30   92.4   0.0    1.4e-30   92.2   0.0    1.0  1  WP_077076135.1  


Domain annotation for each sequence (and alignments):
>> WP_077076135.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   92.2   0.0   1.4e-30   1.4e-30       3     114 ..      10     116 ..       8     119 .. 0.93

  Alignments for each domain:
  == domain 1  score: 92.2 bits;  conditional E-value: 1.4e-30
             PCC   3 fvlrlepGedilesleefareegiraacvlsaiGavsnatlglvdgeekeyeekellgpfEilslsGtisptdgepflHlhvsladedgqvvgGh 97 
                     ++++l++Gedi++sle+++ ee+i++++++s+iGa  + ++g++    k+ye++ +  p+Ei+s+sG+i++  g+p++H+h+ +a++d+ ++gGh
  WP_077076135.1  10 VIVKLDEGEDIIKSLEKVLVEENIKNGFIVSGIGAGVELEIGYLR--GKTYEREIFSPPMEITSFSGSITE--GDPKMHIHINAAGPDHVTYGGH 100
                     799****************************************97..77788999999************9..77******************** PP

             PCC  98 lveglvaattvevviae 114
                     l++g    + +e+ + +
  WP_077076135.1 101 LFSGKA-KPLMEILLFS 116
                     **9955.7****99876 PP



Or compare WP_077076135.1 to CDD or PaperBLAST