biolip::2h6lA has 140 amino acids
Query: PCC [M=117]
Accession: PF03479.19
Description: Plants and Prokaryotes Conserved (PCC) domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.7e-39 121.0 0.0 1.9e-39 120.9 0.0 1.0 1 biolip::2h6lA
Domain annotation for each sequence (and alignments):
>> biolip::2h6lA
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 120.9 0.0 1.9e-39 1.9e-39 3 116 .. 12 121 .. 10 122 .. 0.96
Alignments for each domain:
== domain 1 score: 120.9 bits; conditional E-value: 1.9e-39
PCC 3 fvlrlepGedilesleefareegiraacvlsaiGavsnatlglvdgeekeyeekellgpfEilslsGtisptdgepflHlhvsladedgqvvgGhl 98
f+lrl+ G+d++ ++eef++e+gi+aa++ saiGav++a +g++d+e+key +kel +p+EilslsG++s +d++pf+H+hv l+++ g+v+gGhl
biolip::2h6lA 12 FLLRLDYGKDLVRQIEEFLEEKGIHAAHI-SAIGAVRSAVIGYYDQEKKEYVKKELMEPLEILSLSGNVSMKDSKPFCHIHVLLGKD-GEVYGGHL 105
899**************************.*****************************************9999***********9.******** PP
PCC 99 veglvaattvevviaefe 116
+++ v +++ev++ ++
biolip::2h6lA 106 FSAEV--FACEVFVLPLS 121
*7777..9*****98765 PP
Or compare biolip::2h6lA to CDD or PaperBLAST