PaperBLAST – Find papers about a protein or its homologs

 

Align NP_181270.1 to PF03649 (UPF0014)

NP_181270.1 has 273 amino acids

Query:       UPF0014  [M=242]
Accession:   PF03649.13
Description: Uncharacterised protein family (UPF0014)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    5.3e-71  224.9  20.6      6e-71  224.7  20.6    1.0  1  NP_181270.1  


Domain annotation for each sequence (and alignments):
>> NP_181270.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  224.7  20.6     6e-71     6e-71       5     242 .]      26     259 ..      22     259 .. 0.98

  Alignments for each domain:
  == domain 1  score: 224.7 bits;  conditional E-value: 6e-71
      UPF0014   5 alalllvlialllslvlklglekelliaavrmvvQLllvGyvLklifalnslllvllillvmllvAaieaakrvkkklkklllivllsllvstlltll 102
                  a+al++vl+a++ls+ ++l+le e+++++ r+++QL ++G+vL++if++++  +++l +l+m+ vA+++a +r ++++++   ++ ls+l++t +t++
  NP_181270.1  26 AAALVVVLLAVILSYSQNLSLEGEMIYSVSRSFLQLSVIGFVLQFIFNQENSGWIILAYLFMVSVAGYTAGQR-ARHVPRGKYVAGLSILAGTSITMF 122
                  78999********************************************************************.778888888*************** PP

      UPF0014 103 lllllviqpepwyepqylIPlaGmilGnamnaialalerllselksereeiealLalGatpkeAvkeivreairaaliPtinsmatvGlVsLPGmmtG 200
                  ll+ll++    +++p+y+IP+aGm++Gnam+++++++++l +++k + + +e++LalGatp++A+ + v++a+  +l P ++s +tvGl+sLPG+mtG
  NP_181270.1 123 LLVLLNV---FPFTPRYMIPIAGMLVGNAMTVTGVTMKQLRDDIKMQLNLVETALALGATPRQATLQQVKRALVISLSPVLDSCKTVGLISLPGAMTG 217
                  ****999...9*************************************************************************************** PP

      UPF0014 201 qiLaGaspleAvkyqilimfmilastalstvlvvlllyrrlf 242
                  +i++GaspleA+++qi++m m+++++++s++++++l+  ++f
  NP_181270.1 218 MIMGGASPLEAIQLQIVVMNMMVGAATVSSITSTYLCWPSFF 259
                  ************************************998887 PP



Or compare NP_181270.1 to CDD or PaperBLAST