PaperBLAST – Find papers about a protein or its homologs

 

Align NP_415024.4 to PF03649 (UPF0014)

NP_415024.4 has 259 amino acids

Query:       UPF0014  [M=242]
Accession:   PF03649.13
Description: Uncharacterised protein family (UPF0014)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    6.8e-86  273.6  18.5    7.7e-86  273.4  18.5    1.0  1  NP_415024.4  


Domain annotation for each sequence (and alignments):
>> NP_415024.4  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  273.4  18.5   7.7e-86   7.7e-86       3     242 .]      10     245 ..       8     245 .. 0.99

  Alignments for each domain:
  == domain 1  score: 273.4 bits;  conditional E-value: 7.7e-86
      UPF0014   3 qlalalllvlialllslvlklglekelliaavrmvvQLllvGyvLklifalnslllvllillvmllvAaieaakrvkkklkklllivllsllvstllt 100
                  +lalal+lv++a+l+s+++kl lek++l+++ r+++QL++vGyvLk+if++++  l+ll++l+++++Aa++a kr +k ++k+++ ++++++v++ +t
  NP_415024.4  10 SLALALMLVVVAILISHKEKLALEKDILWSVGRAIIQLIIVGYVLKYIFSVDDASLTLLMVLFICFNAAWNAQKR-SKYIAKAFISSFIAITVGAGIT 106
                  79*************************************************************************.999******************* PP

      UPF0014 101 lllllllviqpepwyepqylIPlaGmilGnamnaialalerllselksereeiealLalGatpkeAvkeivreairaaliPtinsmatvGlVsLPGmm 198
                  l++l+l   ++++++ p+++IP+aGmi Gnam a++l++++l +++ se+++i+++L+lGatpk+A++ ++r++iraaliPt++s++tvGlVsLPGmm
  NP_415024.4 107 LAVLIL---SGSIEFIPMQVIPIAGMIAGNAMVAVGLCYNNLGQRVISEQQQIQEKLSLGATPKQASAILIRDSIRAALIPTVDSAKTVGLVSLPGMM 201
                  ***999...99*************************************************************************************** PP

      UPF0014 199 tGqiLaGaspleAvkyqilimfmilastalstvlvvlllyrrlf 242
                  +G+i+aG++p++A+kyqi+++fm+l++++lst+++++l+yr+++
  NP_415024.4 202 SGLIFAGIDPVKAIKYQIMVTFMLLSTASLSTIIACYLTYRKFY 245
                  *****************************************996 PP



Or compare NP_415024.4 to CDD or PaperBLAST