PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q5W7C1 to PF03649 (UPF0014)

SwissProt::Q5W7C1 has 285 amino acids

Query:       UPF0014  [M=242]
Accession:   PF03649.13
Description: Uncharacterised protein family (UPF0014)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    1.4e-72  230.0  24.2    1.6e-72  229.8  24.2    1.1  1  SwissProt::Q5W7C1  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q5W7C1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  229.8  24.2   1.6e-72   1.6e-72       5     242 .]      38     271 ..      34     271 .. 0.98

  Alignments for each domain:
  == domain 1  score: 229.8 bits;  conditional E-value: 1.6e-72
            UPF0014   5 alalllvlialllslvlklglekelliaavrmvvQLllvGyvLklifalnslllvllillvmllvAaieaakrvkkklkklllivllsllvs 96 
                        ++a ++v++a++ls++++lgle e+l+a++r+++QL ++G+vL++if+++s +++ll +l+m++vA+++a +r ++++++   i+++s+l++
  SwissProt::Q5W7C1  38 VAATAVVAMAVALSFTQRLGLEGEMLYAMARAFLQLSVIGFVLQFIFTQKSAAWILLAYLFMVTVAGYTAGQR-ARHVPRGKHIAAVSILAG 128
                        578999*******************************************************************.888999999********* PP

            UPF0014  97 tlltlllllllviqpepwyepqylIPlaGmilGnamnaialalerllselksereeiealLalGatpkeAvkeivreairaaliPtinsmat 188
                        t +t++ll++l +    +++p+y+IP+aGm++Gnam+++++++++l +++  +r  +e++LalGatp++A+++ vr+++  al P i++++t
  SwissProt::Q5W7C1 129 TSVTMALLVALRV---FPFTPRYIIPVAGMMVGNAMTVTGVTMKKLREDVGMQRGVVETALALGATPRQATARQVRRSLVIALSPVIDNAKT 217
                        **********998...9*************************************************************************** PP

            UPF0014 189 vGlVsLPGmmtGqiLaGaspleAvkyqilimfmilastalstvlvvlllyrrlf 242
                        vGl++LPG+mtG+i++GaspleA+++qi++m m+++++++s++l+++l+   +f
  SwissProt::Q5W7C1 218 VGLIALPGAMTGLIMGGASPLEAIQLQIVVMNMLMGASTVSSILSTYLCWPAFF 271
                        ************************************************988887 PP



Or compare SwissProt::Q5W7C1 to CDD or PaperBLAST