PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS104591 to PF03649 (UPF0014)

VIMSS104591 has 258 amino acids

Query:       UPF0014  [M=242]
Accession:   PF03649.13
Description: Uncharacterised protein family (UPF0014)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.4e-69  220.2  17.5    1.6e-69  220.0  17.5    1.0  1  VIMSS104591  


Domain annotation for each sequence (and alignments):
>> VIMSS104591  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  220.0  17.5   1.6e-69   1.6e-69       2     242 .]       4     241 ..       3     241 .. 0.99

  Alignments for each domain:
  == domain 1  score: 220.0 bits;  conditional E-value: 1.6e-69
      UPF0014   2 lqlalalllvlialllslvlklglekelliaavrmvvQLllvGyvLklifalnslllvllillvmllvAaieaakrvkkklkklllivllsllvstll 99 
                  ++l+l++ll++i++++s++++l + k+l++a++r+vvQL+++G++L++if++n+ +l +l++lv++++A++++ +r++  ++++++i++l+++++t+l
  VIMSS104591   4 TALGLTALLLVIPIIISYKEGLHIIKDLIVATLRAVVQLIILGFLLHYIFKINDKWLLILCVLVIIINASWNTISRASPVMHHVFWISFLAIFIGTAL 101
                  57999********************************************************************************************* PP

      UPF0014 100 tlllllllviqpepwyepqylIPlaGmilGnamnaialalerllselksereeiealLalGatpkeAvkeivreairaaliPtinsmatvGlVsLPGm 197
                   l+ +++   ++++ ++++ +IP+ Gm+  n + ai la+++l +++ ++ ++ie +L+l atpk A+k  +re+ir a++Pti+s++t GlVs+PGm
  VIMSS104591 102 PLAGTVA---TGAIHFTANEVIPIGGMLANNGLIAINLAYQNLDRAFVQDGTNIESKLSLAATPKLASKGAIRESIRLAIVPTIDSVKTYGLVSIPGM 196
                  ***9999...899************************************************************************************* PP

      UPF0014 198 mtGqiLaGaspleAvkyqilimfmilastalstvlvvlllyrrlf 242
                  mtG+i++G+ pl+A+k+q+l++f+ +++t++s++++++l+y ++f
  VIMSS104591 197 MTGLIIGGVPPLQAIKFQLLVVFIHTTATIMSALIATYLSYGQFF 241
                  ******************************************998 PP



Or compare VIMSS104591 to CDD or PaperBLAST