PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS1087 to PF03649 (UPF0014)

VIMSS1087 has 263 amino acids

Query:       UPF0014  [M=242]
Accession:   PF03649.13
Description: Uncharacterised protein family (UPF0014)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence  Description
    ------- ------ -----    ------- ------ -----   ---- --  --------  -----------
    8.7e-87  276.6  17.9    9.8e-87  276.4  17.9    1.0  1  VIMSS1087  


Domain annotation for each sequence (and alignments):
>> VIMSS1087  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  276.4  17.9   9.8e-87   9.8e-87       2     242 .]      10     255 ..       9     255 .. 0.97

  Alignments for each domain:
  == domain 1  score: 276.4 bits;  conditional E-value: 9.8e-87
    UPF0014   2 lqlalalllvlialllslvlklglekelliaavrmvvQLllvGyvLklifalnslllvllillvmllvAaieaakrvkkklkklll.....ivllsllvs 96 
                +ql+ a+++v++ +l+ +++++  eke+l+a++rm+ QL++ G+vL++i+++ s+l+++l +lvm ++A+++++kr++ +l+  ++      +++s+ ++
  VIMSS1087  10 IQLLSAYIFVVVLMLILRIRRIPREKEVLVASIRMTFQLVMAGFVLSYILDHPSPLYTILAVLVMEIFAIYNVYKRARLSLPARVKkrlelFIAISVSTG 109
                89***************************************************************************88887777666667899999999 PP

    UPF0014  97 tlltlllllllviqpepwyepqylIPlaGmilGnamnaialalerllselksereeiealLalGatpkeAvkeivreairaaliPtinsmatvGlVsLPG 196
                tll l+++l++v++ +pw++p+y+IPlaGmi+Gn+m++++l++++l ++++ +++ +ea+L+lGa+pk+Av+ + ++a+++a++Pt+nsm  +G+V+LPG
  VIMSS1087 110 TLLSLVYFLYVVVRISPWFDPRYVIPLAGMIIGNSMTGVSLGVKTLSESITIQKDIVEAALMLGARPKDAVRMFSDRAFDSAILPTLNSMIGMGIVFLPG 209
                **************************************************************************************************** PP

    UPF0014 197 mmtGqiLaGaspleAvkyqilimfmilastalstvlvvlllyrrlf 242
                mmtGqiL+Gasp++A+kyqi+im++il+ +++s+ ++++l+y+ +f
  VIMSS1087 210 MMTGQILSGASPITAIKYQIAIMLGILGEVTISVSVFLYLGYKAFF 255
                *******************************************998 PP



Or compare VIMSS1087 to CDD or PaperBLAST