PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS34773 to PF03649 (UPF0014)

VIMSS34773 has 219 amino acids

Query:       UPF0014  [M=242]
Accession:   PF03649.13
Description: Uncharacterised protein family (UPF0014)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    1.1e-35  109.3   0.8    1.4e-35  108.9   0.8    1.1  1  VIMSS34773  


Domain annotation for each sequence (and alignments):
>> VIMSS34773  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  108.9   0.8   1.4e-35   1.4e-35     151     242 .]     112     203 ..     107     203 .. 0.96

  Alignments for each domain:
  == domain 1  score: 108.9 bits;  conditional E-value: 1.4e-35
     UPF0014 151 eeiealLalGatpkeAvkeivreairaaliPtinsmatvGlVsLPGmmtGqiLaGaspleAvkyqilimfmilastalstvlvvlllyrrlf 242
                 +e+ a+L+lG++++eA+ +  r+a+r+aliP+i+s+++vGl+sLPG+m+G+iLaG++pl+A++yqi++m+++la+ta++++++  l+ r lf
  VIMSS34773 112 TELLARLCLGQSAREAFLPHQRSALRTALIPAIDSTKVVGLISLPGAMSGLILAGVDPLTAIRYQIVVMYLLLAATAVAALTCARLAERALF 203
                 67889*********************************************************************************999887 PP



Or compare VIMSS34773 to CDD or PaperBLAST