PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS674336 to PF03649 (UPF0014)

VIMSS674336 has 294 amino acids

Query:       UPF0014  [M=242]
Accession:   PF03649.13
Description: Uncharacterised protein family (UPF0014)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    2.9e-76  242.1  19.9    3.3e-76  241.9  19.9    1.0  1  VIMSS674336  


Domain annotation for each sequence (and alignments):
>> VIMSS674336  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  241.9  19.9   3.3e-76   3.3e-76       2     241 ..      40     279 ..      39     280 .. 0.99

  Alignments for each domain:
  == domain 1  score: 241.9 bits;  conditional E-value: 3.3e-76
      UPF0014   2 lqlalalllvlialllslvlklglekelliaavrmvvQLllvGyvLklifalnslllvllillvmllvAaieaakrvkkklkklllivllsllvstll 99 
                   +l+++ +l++i+l++s+ ++l ++ke l+++ rm++QL+lvG++L+++f+ln++ +++++llvml+v+a +++++++   ++ll ++l++l+ ++l 
  VIMSS674336  40 GALLAFSSLLVIPLIISHCYQLAIAKEALLSVGRMALQLILVGFYLEYLFTLNDWRINVIWLLVMLTVGASSIVSKAHLPQSQLLFPTLFGLAGGMLP 137
                  6789999******************************************************************************************* PP

      UPF0014 100 tlllllllviqpepwyepqylIPlaGmilGnamnaialalerllselksereeiealLalGatpkeAvkeivreairaaliPtinsmatvGlVsLPGm 197
                  +l +ll+ +i p+pwy+ qy+IPlaGm+lGn+++++ +al++l++ ++++r+e+ea++alGa+p+ A+  +vr+a+++++ P++ sma++GlV+LPGm
  VIMSS674336 138 ILSVLLVGIIVPTPWYHTQYMIPLAGMLLGNSLSGNIVALQNLFDCYRNRRNEYEAAIALGASPRYASLLFVRQAMQKSFAPILASMAATGLVTLPGM 235
                  ************************************************************************************************** PP

      UPF0014 198 mtGqiLaGaspleAvkyqilimfmilastalstvlvvlllyrrl 241
                  mtGqiL+Gasp+ A+kyq++im++i+++ +ls+v++++l+ +r+
  VIMSS674336 236 MTGQILGGASPMVAIKYQLIIMIAIFVTLTLSVVITLELVLHRC 279
                  ***************************************99886 PP



Or compare VIMSS674336 to CDD or PaperBLAST